SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001897569.1.25112 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001897569.1.25112
Domain Number 1 Region: 105-249
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.71e-34
Family Ankyrin repeat 0.00025
Further Details:      
 
Weak hits

Sequence:  XP_001897569.1.25112
Domain Number - Region: 48-120
Classification Level Classification E-value
Superfamily Cytochromes 0.0906
Family Cytochrome c'-like 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_001897569.1.25112
Sequence length 264
Comment Ankyrin repeat containing protein [Brugia malayi]; AA=GCF_000002995.3; RF=representative genome; TAX=6279; STAX=6279; NAME=Brugia malayi; AL=Scaffold; RT=Major
Sequence
MVDSENEEPMEIHSSTVTTDYEHNRPGSSMSTATSSTLCQSFEDFDGNNAAEMEDTIPSV
IDFTRQSKLMAKIRDNKRKLPSRWDDDDDDGILAKDMNDPKEQVLTAAEDGNLESLKDLI
ENNPSLLSARDVDGYTALHRAAYSGHTDIVGYLLSIGANPEWNTNDGWTVLHCAATWSMC
EVVALLLRHGVDVNSRSHGNLTPLHLAITSNQSEDRVLTTVRYLLEAPGIDAAAVSNSGD
SPLRVAERTSAKITEMLMRYFSKP
Download sequence
Identical sequences A0A0H5S6X3
Bm1_30650 Bm3630 XP_001897569.1.25112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]