SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001897719.1.25112 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001897719.1.25112
Domain Number 1 Region: 112-148
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000135
Family EGF-type module 0.032
Further Details:      
 
Weak hits

Sequence:  XP_001897719.1.25112
Domain Number - Region: 79-100
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0033
Family EGF-type module 0.069
Further Details:      
 
Domain Number - Region: 167-183
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0407
Family EGF-type module 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_001897719.1.25112
Sequence length 216
Comment EGF-like domain containing protein [Brugia malayi]; AA=GCF_000002995.3; RF=representative genome; TAX=6279; STAX=6279; NAME=Brugia malayi; AL=Scaffold; RT=Major
Sequence
MSIAPIIICQQRHKDKDDAYVDLVPLNLIPEGCSLDSYYGYGIIDGSLEKCDKYSEAKAG
GEEFSSEYEEIKCRTLRVHGRMKNNKCECKPGWKGPICNEYYGCPTGFSLYNSVCTPNSC
QHNGTIAIGSKQIECMCKAPWDGRNCERLACWRMAPKEHERRWRNAGDKCRCADEYEGDN
CDKIIKCRNDGEVIDGRHSGPDPLPIRYNLKGKCNK
Download sequence
Identical sequences Bm1_31370 XP_001897719.1.25112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]