SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001898141.1.25112 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001898141.1.25112
Domain Number 1 Region: 622-804
Classification Level Classification E-value
Superfamily Kelch motif 5.23e-48
Family Kelch motif 0.0000607
Further Details:      
 
Domain Number 2 Region: 100-152,190-252
Classification Level Classification E-value
Superfamily POZ domain 3.1e-24
Family BTB/POZ domain 0.01
Further Details:      
 
Domain Number 3 Region: 521-596
Classification Level Classification E-value
Superfamily Kelch motif 0.00000000000000955
Family Kelch motif 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_001898141.1.25112
Sequence length 816
Comment Kelch motif family protein [Brugia malayi]; AA=GCF_000002995.3; RF=representative genome; TAX=6279; STAX=6279; NAME=Brugia malayi; AL=Scaffold; RT=Major
Sequence
MDDIHQPTNFGHCTVDDKRFSLLTSDNHTFLCQNNNNVNDNSDNNDDDDDDDDDDKNNDG
SNRNDGPFLEPKIPVRSTSLHASESDASMVIHSEEIMLKMFDNSMQDTLLSHLSTFRRNR
ELCDVVLFVHEKEILAHKIVLAACSPALMDMFVRSENGDRSSKRVSTTMLSTAGTASPPL
TTALALPITTQPFSYYEFAEADYDCFEAIVNYAYSSHLEISSRKVGELYKTACALQVTPI
ARACARYLIENLNITDCIGIRRQANINDDVLVEQVDNFIAKNFAQIVDENPGFTHLPLIK
VRLILSSDDIKKLCCGEDIALRVVQYFQSLPHINDRIEQWIEQLVEKTHMLYTDTDCRLQ
DCLGMDDRSSVGASDIIQDYKRTGGYLPRTYSGSNVLEVQNPAHHITGATQVHLNSARLT
NTKLSSAESNSSLSSNAEPDDESYKLIAVHRTAGKNKKDFWITLAVFHRCLVALSIQLSE
AENVIKSRTTSQVVEPSPIFEIEQQQEIAEETVVRLVSSESSSRIPLPHMESPRCSVGGA
FINGKIIVCGGYDRGKCLESVEEYNLLKKNWRRLADMAQCRGRFDAAVVGSKVYAVAALL
LAIRKFHALANFKICAKLSNLDMSVKFLILCCAALDGLIYCIGGCCEQIVLSECERYNPE
LDEWASITPLRTARFQASCTSWHGLVIVCGGCNGWKCLDSVDAYSPKTGKWQRLASLKTA
RRGSAVAVVKDSLFVIGGHDGTHSLNSVEILDDPTGEWRSGPSLTIPRANVKATVASGDE
IYLLGGFDGTQFLSSIEVLNSGSNCKAGGIGSERQN
Download sequence
Identical sequences Bm1_33480 XP_001898141.1.25112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]