SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001898157.1.25112 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001898157.1.25112
Domain Number 1 Region: 505-578,648-753
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.78e-43
Family Ankyrin repeat 0.00022
Further Details:      
 
Domain Number 2 Region: 47-96
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000077
Family EGF-type module 0.013
Further Details:      
 
Domain Number 3 Region: 177-205
Classification Level Classification E-value
Superfamily Notch domain 0.00000536
Family Notch domain 0.0048
Further Details:      
 
Domain Number 4 Region: 90-130
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000151
Family EGF-type module 0.019
Further Details:      
 
Domain Number 5 Region: 212-243
Classification Level Classification E-value
Superfamily Notch domain 0.0000157
Family Notch domain 0.0067
Further Details:      
 
Domain Number 6 Region: 127-164
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000391
Family EGF-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_001898157.1.25112
Sequence length 893
Comment EGF-like domain containing protein [Brugia malayi]; AA=GCF_000002995.3; RF=representative genome; TAX=6279; STAX=6279; NAME=Brugia malayi; AL=Scaffold; RT=Major
Sequence
MIVVLHFTWFTPVLLIAKQVYSQCCVAMVLINVALALLNCLLALPSCFDPAEPCLNGGVC
VKQVTNKAHSTLCSCSAGYSGEKCEKVLNVCEAFPHYCNAGTCVSINGSAICHCSMGYFG
HNCEYTFDKCKVGNMCRNGGTCIDGICFCTDGFSGEVCERHVPERDDYLRAGCEEHPEFC
ALRFADGTCNEECNNEKCFFDGFDCVVSTQECRLSDYCALHYLDGKCDEKCAVAECGYDG
MDCDRNMLLRDLTDSSTIGIKLHNPVRLALDSNNKTRIYEWSFENGVGKEINLREWEMSR
NATSVLLYVDIDSTFCEQRLHLNTTNVLPCFTDIFGAVAYLHTALYDEAKNRISLGDVTV
EGLFVESDRSRSLPIFAIFITCFVFIGMILSCFYGIYGFFDVLKRQNIGKNHAPVWKVPS
SLQSNATSWSTVSSVEDYLLNEDICRRDGLPPLSRLFSNSTSCRREQPKDFKNHYRTAKN
NEQKILISLDAYFSDNGNENCHLGPDLLKAVKCNDIEAVSFLVLHGADVNCFDSDKNTAL
HHAVVVNNDQIIRLLLSTHRCNLRAVNVLGQTPLTLTVKFAHVSDLCARCILDFMYTEYY
RQTKVRNDTFTPQLISSQNGVSRLMTSNNYREFDPSLKQPERDGCIFTRDILSEKDDPTL
TDIFGRTALHYAALNRRVNLLPILYSFGLKLDTEDTKGETPLYLAAREGYLDMVNLLLSF
GANSEISDQLGRTPLDVARERGHCFIVEFLENAAVNNVDIMKTRKRKRSRKPSSAAKCKS
KLGSYIPVASSQENISLTSSSIATGLNDDYTEDVGDIDEDMTISSSFLNSVESFVLTPAG
QIIAEAEKELDLDVVDPAVPDYIDLSTNSCLPTEFFSNNAFSVEPFQVRRSSE
Download sequence
Identical sequences Bm1_33555 XP_001898157.1.25112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]