SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001899211.1.25112 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_001899211.1.25112
Domain Number - Region: 7-96
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.068
Family Xylanase/endoglucanase 11/12 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_001899211.1.25112
Sequence length 111
Comment hypothetical protein Bm1_38790 [Brugia malayi]; AA=GCF_000002995.3; RF=representative genome; TAX=6279; STAX=6279; NAME=Brugia malayi; AL=Scaffold; RT=Major
Sequence
MSTSSSTHQNAIQLDKFHATAQLPRPICLTVPIQSEQNQNVCVTIAMNNRGNAFYWFGAG
CGRQECFQHTAGKNVPNLTRNVQLDMTQEHQYCYTYVYALSTDVIQRQEPL
Download sequence
Identical sequences XP_001899211.1.25112 Bm1_38790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]