SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001902417.1.25112 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001902417.1.25112
Domain Number 1 Region: 44-175
Classification Level Classification E-value
Superfamily POZ domain 1.36e-30
Family BTB/POZ domain 0.0022
Further Details:      
 
Domain Number 2 Region: 328-407
Classification Level Classification E-value
Superfamily Kelch motif 0.0000000000000126
Family Kelch motif 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_001902417.1.25112
Sequence length 414
Comment BTB/POZ domain containing protein [Brugia malayi]; AA=GCF_000002995.3; RF=representative genome; TAX=6279; STAX=6279; NAME=Brugia malayi; AL=Scaffold; RT=Major
Sequence
MERWRAESESTEVVIGTLESETHFCTSPSSLARHFNSKQSSTVYNNDNFPSNVLRSLNTF
RKDERFCDVILMASLKPEDGAESDGSRDVKIVAHRAVLAAGCPYFSAMFSGAMKESKQEN
IFLKGIDGTSLLALIDYMYSGRLTINEQNVQSLLTTGSLLQMACVRDACSRFLLEQLDPS
NCLGIANFAVAHGCTQLAHAATTFVQQHFNHVVKCDEFLALSKHQVVEIISSDHLTTTGE
DKVYEAVVRWVMHDILNRRDAFPDLMAHVRLPLLPRDYLTDKVDPDILVRQSSECKDYLL
EAYRYHLKDERGEENERSRPRQPIPLSKLIMLIGGQAPKAIANVDVFDLDALRWMPLNAL
PQRRCRCGVGELKDFVYAVGGFNGSLRVKSVDAYDVHTDRWFAAPPMDARYMHN
Download sequence
Identical sequences XP_001902417.1.25112 Bm1_54795

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]