SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001917093.1.31192 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001917093.1.31192
Domain Number 1 Region: 52-333
Classification Level Classification E-value
Superfamily Creatinase/aminopeptidase 1.57e-82
Family Creatinase/aminopeptidase 0.00000303
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_001917093.1.31192
Sequence length 335
Comment PREDICTED: methionine aminopeptidase 1D, mitochondrial [Equus caballus]; AA=GCF_000002305.2; RF=representative genome; TAX=9796; STAX=9796; NAME=Equus caballus; breed=thoroughbred; AL=Chromosome; RT=Major
Sequence
MAAPSGVHRLVLRGCHRILSLPLNHIYLHKQSSSQQRRNFFFRRQREISHSIVLPAAVSS
AHPVPKHIKKPDYVTTGIVPDWGDSIEVKNEDQIQGLRQACQLARHVLLLAGKSLKVDMT
TEEIDALVHQEIISHDAYPSPLGYGGFPKSVCTSVNNVLCHGIPDSRPLQDGDIINIDVT
VYYNGYHGDTSETFLVGNVDECGKKLVEVARRCRDEAIAACRAGAPFSVIGNTISRITHQ
NGLQVCPHFVGHGIGSYFHGHPEIWHHANDSDLLMEEGMAFTIEPIITEGSPEFKVLRMR
GTAVSLDNQRSAQFEHTILITSGGAQILTQLPHEA
Download sequence
Identical sequences F6Z5G9
ENSECAP00000019136 XP_001917093.1.31192 9796.ENSECAP00000019136 ENSECAP00000019136

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]