SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001925115.3.46622 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001925115.3.46622
Domain Number 1 Region: 4-285
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 1.28e-108
Family Inorganic pyrophosphatase 0.0000000526
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_001925115.3.46622
Sequence length 289
Comment inorganic pyrophosphatase [Sus scrofa]; AA=GCF_000003025.6; RF=representative genome; TAX=9823; STAX=9823; NAME=Sus scrofa; breed=Duroc; AL=Chromosome; RT=Major
Sequence
MSSFSSEERSAPFTLEYRVFLKNEKGQYISPFHDIPIYADKDVFHMVVEVPRWSNAKMEI
ATKDPLNPIKQDVKKGKLRYVANLFPYKGYIWNYGAIPQTWEDPGHSDKHTGCCGDNDPI
DVCEIGSKVCARGEIIRVKVLGILAMIDEGETDWKVIAINVDDPDAANYNDINDVKRLKP
GYLEATVDWFRRYKVPDGKPENQFAFNAEFKDKDFAVDIIKSTHDYWRALVTKKTDGKGI
SCMNTTVSESPFQCDPDAAKAIVDALPPPCESACTIPTDVDKWFHHQKN
Download sequence
Identical sequences F1SUE3
ENSSSCP00000010939 XP_001925115.3.46622 ENSSSCP00000010939

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]