SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001927140.1.46622 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001927140.1.46622
Domain Number 1 Region: 111-173
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000181
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 2 Region: 258-316
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000292
Family Complement control module/SCR domain 0.0025
Further Details:      
 
Domain Number 3 Region: 74-126
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000639
Family Complement control module/SCR domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_001927140.1.46622
Sequence length 461
Comment sushi repeat-containing protein SRPX isoform X1 [Sus scrofa]; AA=GCF_000003025.6; RF=representative genome; TAX=9823; STAX=9823; NAME=Sus scrofa; breed=Duroc; AL=Chromosome; RT=Major
Sequence
MGSPALRPALLLLPPLLLLLRVPPSRGFPGSGDSPLEDDEVGYSYARYKDTPWCSPIKVK
FGDVYCRAPQGGYYKTALGTRCDIRCRKGYELHGSSQLICQSNKRWSDKVICKQKRCPTL
AMPANGGFKCVDGAYFNSRCEYYCSPGYTLKGERTVTCMDNKAWSGRPASCVDIEPPRIK
CPSVKERIAEPNKLTVRVSWETPEGRDTADGILTDVILKGLPPGSHFPEGDHKIQYTVYD
RAENKGICKFRVKVRVRRCGKLNAPENGYMRCSSDGDNYGATCEFSCVGGYELQGSPARV
CQSNLAWSGTEPTCAAMNVNVGVRTAAALLDQFYEKRRLLILSTPTARNLLYRMQLGMLQ
QAQCGLDLRHITVVELVGVFPTLIGRIGAKIMPPALALQLRLLLRIPLYSFSMVLVDKHG
MDKERYVSLVTPVALFNLIDTFPLRKEEMVLQAEMGQTCST
Download sequence
Identical sequences K7GKF8
XP_001927140.1.46622 9823.ENSSSCP00000013020

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]