SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001927665.3.46622 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001927665.3.46622
Domain Number 1 Region: 195-505
Classification Level Classification E-value
Superfamily Cysteine proteinases 8.83e-119
Family Transglutaminase core 0.0000000000228
Further Details:      
 
Domain Number 2 Region: 11-194
Classification Level Classification E-value
Superfamily E set domains 2.41e-55
Family Transglutaminase N-terminal domain 0.0000000305
Further Details:      
 
Domain Number 3 Region: 520-631
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 1.1e-31
Family Transglutaminase, two C-terminal domains 0.00000341
Further Details:      
 
Domain Number 4 Region: 633-731
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 2.22e-27
Family Transglutaminase, two C-terminal domains 0.00000419
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_001927665.3.46622
Sequence length 735
Comment coagulation factor XIII A chain [Sus scrofa]; AA=GCF_000003025.6; RF=representative genome; TAX=9823; STAX=9823; NAME=Sus scrofa; breed=Duroc; AL=Chromosome; RT=Major
Sequence
MAETPGTGAAFGGRRALPPNTSNAEENDPPTVELQGGLMPRGFNPQDYLNVTDVHLFKER
WDSNKVDHHTDKYDSKKLIVRRGQPFYIQIDFSRPYDPRRDLFRVEYVIGRYPQENKGTY
IPVPIVSELQRGKWGAKVITTEDRSVRLSVQPSPDCIVGKFRMYVAVWTPYGVIRTSRNP
ETDTYILFNPWCEEDAVYLDNDKEREEYVLNDIGVIFYGEFNDIKSRSWSYGQFEEGILD
ACLYMMDRAKMDLSGRGNPIKVSRVGSAMVNAKDDEGVLVGSWDNVYSYGVPPSAWTGSV
DILLEYKSSQTPVRYGQCWVFAGVFNTFLRCLGIPARVVTNYFSAHDNNANLQLDIFLEE
DGNVNSKLTKDSVWNYHCWNEAWMTRPDLPVGFGGWQVVDSTPQENSDGMYRCGPASVQA
IKHGHVCFQFDAPFVFAEVNSDVIYITAKKDGTHVVKTLDTTHIGKLIVTKQVGADGMKD
ITDTYKFQEGQEEERLALETALMYGAKKPLSTEGIPKSRSDIHMDFEVERAVLGRDFKVV
LTFRNNSPTRYSVTAYLSGNITFYTGVSKGEFKNETFNVTLEPLSFKTEAVWVRAGEYMG
QLLEQAFLHFFVTARVNETNDVLAKQKSVVLTIPKISVKVRGTQAVGSDMVVTVEFTNPL
NEPLQNVWMRLDGPGVTRPLRKIFREIRPNATVQWEEVCRPWVSGPRKLMASMTSDSLRH
VYGELNLHIQRRPSV
Download sequence
Identical sequences K7GQL2
9823.ENSSSCP00000001088 ENSSSCP00000001089 XP_001927665.3.46622 ENSSSCP00000030183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]