SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001927879.1.46622 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001927879.1.46622
Domain Number 1 Region: 380-668,777-819
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.78e-73
Family FAD-linked reductases, N-terminal domain 0.00042
Further Details:      
 
Domain Number 2 Region: 653-767
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 1.35e-24
Family L-aminoacid/polyamine oxidase 0.00027
Further Details:      
 
Domain Number 3 Region: 270-376
Classification Level Classification E-value
Superfamily Homeodomain-like 6.81e-20
Family SWIRM domain 0.014
Further Details:      
 
Weak hits

Sequence:  XP_001927879.1.46622
Domain Number - Region: 61-105
Classification Level Classification E-value
Superfamily RING/U-box 0.0219
Family RING finger domain, C3HC4 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_001927879.1.46622
Sequence length 820
Comment lysine-specific histone demethylase 1B [Sus scrofa]; AA=GCF_000003025.6; RF=representative genome; TAX=9823; STAX=9823; NAME=Sus scrofa; breed=Duroc; AL=Chromosome; RT=Major
Sequence
MATPRGRTKKKASFDHSPDSLPLRSSGRQAKKKATEMTDEDEDGGSEKKYRKCEKAGCTA
TCPVCFASASERCAKNGYTSRWYHLSCGEHFCNECFDHYYRSHKDGYDKYTTWKKIWTSN
GKTEPSPKAFMADQQLPYWVQCTKPECRKWRQLTKEIQLTPQIAKTYRCGMKPNTAVKPE
TSDHCSLPEDLRVSEVSNHWWYSMLILPPLLKDSVAAPLLSAYYPDCVGMSPSCTSTHRA
ASDTSPGKLEHSKAVPSVLVPGMNRYFQPFYQPNECGKALCVRPDVMELDELYEFPEYSR
DPTMYLALRNLILALWYTNCKEALTPQKCIPHIIVRGLVRIRCVQEVERILYFMTRKGLI
NTGVLSVGPDQHLLPKDYHNKSVIIIGAGPAGLAAARQLHNFGIKVTVLEAKDRIGGRVW
DDKSFKGVTVGRGAQIVNGCINNPVALMCEQLGISMHKFGERCDLIQEGGRITDPTIDKR
MDFHFNALLDVVSEWRKDKTQLQDVPLGEKIEEIYKAFIKESGIQFSELEEQVLQFHLSN
LEYACGSNLHQVSARSWDHNEFFAQFAGDHTLLTPGYSVIIEKLAEGLDIRLRSPVQSID
YSGDEVQVSTTDGTRCTAQKVLVTVPLALLQKGAIQFNPPLSDKKMKAINSLGAGIIEKI
ALQFPYRFWDSKVQGADFFGHVPPSVSKRGLFAVFYDMDPQKQHSVLMSVIAGEAVAAVR
SLEDKQVLQQCMASLRELFKEQEVPDPTKYFVTRWSTDPWIQMAYSFVKTGGSGEAYDII
AEEIQGTIFFAGEATNRHFPQTVTGAYLSGVREASKIAAF
Download sequence
Identical sequences ENSSSCP00000001144 XP_001927879.1.46622 XP_013832914.1.46622 ENSSSCP00000001144

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]