SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001930954.1.10593 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001930954.1.10593
Domain Number 1 Region: 310-412
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00000371
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_001930954.1.10593
Sequence length 973
Comment hypothetical protein PTRG_00621 [Pyrenophora tritici-repentis Pt-1C-BFP]; AA=GCF_000149985.1; RF=representative genome; TAX=426418; STAX=45151; NAME=Pyrenophora tritici-repentis Pt-1C-BFP; strain=Pt-1C-BFP; AL=Scaffold; RT=Major
Sequence
MITTGAPLRNWTILLLLCSLPTAVLAEVANGTATDESSATAASGATTQHTSTPTPLTSSI
RRYTDSETTSPYRTINYITHTLRQQCAKATWSAPHEAASTNGTIVERGIVRLQTPIPIRE
GPEGTIKEEEQPASPGTVSEPGATSSGTPSEEPELELETDSPFDNANFLSFEEWKKKNLA
EVGQSPENVGQGRAAAANQPARRRPVNVNALDSLGDEGEISIDFSGFGSPEDGSVANSIQ
QGRHSAGATKAPEGEGKVAPSAWSLSKDAGKTCKERFNYASFDCAATVLKTNKQAKSSSS
ILVENKDSYMLNTCSSDNKFLIVELCDDILVDTVVLANYEFFSSMFRHFRVSVSDRYPVK
MEKWRTLGTFEARNSRDIQPFLITEPQIWARYLRIEFLTQYGNEYYCPLSLLRVHGTTMM
EQFRREEEGARGIDDDDDLEAEGVDVKKPAEDSGPLPPEEIPIEAIKGSSFDSGGSAVAQ
PVGHQATSQDTAVKSAPTIEPSSSSTSTAAMEASAGKVTDTPQTRSISDSPSESLPSPAT
GSSVGRDTNITAARETQSSDRHGPMSGGVDKPQVHSPMSEASSTQSPSVSRDDGSPVSLT
NTAVSSSSNSAAKASTNNTVVSQQTQSPGRGSATQPNAPTPSTQESFFKSIHKRLQYLEA
NSTLSLQYIEEQSRALRDAFVKVEKRQLAKTEKFLDHLNSTVMLELKSFRTMYDQLWQST
VIELESMKERQKSEMGEIGTRLSLMADELVWQKRMAVVQSTLLLLCLGLVLFVRSGTLGS
NADVPIVQQLGSKYTSFFESSPPRSPPESGMARRRRTFKSMWRSESEQDGQQAPSDTETE
GLRSPGQTTYDPLTPDTPSNRHGRDFSPEINSVKAAPHPTQENMPPTPSFEDQAVRIQVL
ETQSGPATPNGTRDSRPSWEEVDRAMDLLKAEEQSQSPPRPKARDRGKKQKRSPLRRAQS
NHESATDEEPPPP
Download sequence
Identical sequences B2VS46
XP_001930954.1.10593 PTRT_00621

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]