SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001932951.1.10593 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001932951.1.10593
Domain Number 1 Region: 1-230
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 1.32e-35
Family Rhamnogalacturonase B, RhgB, N-terminal domain 0.0004
Further Details:      
 
Domain Number 2 Region: 322-497
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.3e-35
Family Rhamnogalacturonase B, RhgB, C-terminal domain 0.0000377
Further Details:      
 
Domain Number 3 Region: 234-312
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.0000000108
Family Rhamnogalacturonase B, RhgB, middle domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_001932951.1.10593
Sequence length 499
Comment rhamnogalacturonan lyase [Pyrenophora tritici-repentis Pt-1C-BFP]; AA=GCF_000149985.1; RF=representative genome; TAX=426418; STAX=45151; NAME=Pyrenophora tritici-repentis Pt-1C-BFP; strain=Pt-1C-BFP; AL=Scaffold; RT=Major
Sequence
MTSIKYRGVEYNGQNGKNSHVESGLAPGTVTIKQYTSPANIIKVTMKVGTLVHTLIFRYG
NPNVYIFMNKKDSSITVSRYILRIPGGIFKNNVNEDTDWVPDGAAAIESGDINGLNGQTW
SKHYSGKKYGRTIDYDYVGYTNANVGMYLIRSDHEKASGGPFFRSLIRRGGSGGPDLYDI
YHYNMGHTDIMRLGLQGPSVLHFTDNGAAPNNNLFARKADWGWLDSLEIDGWVPASRRGA
VAGVGLANMKSGFQYVVGLKSAQAQYWTIATGAWRIDKVLPGDYTLTVYKGELEVHTSTV
TITAGGTATRNTITCSDPADTAVIWRIGDWDGTPKGFLNFGDTPMKPTYMHPSDSRLAKW
DAGNYIIGTSTASGFPGYMWKDINNDHLVYFRLTDAQLAKGAKIRIGVTEGMAGGRPSIS
VGSWSAPLQGDKGQGDTRSLTVGTYRGNNYIYEYNIPASAWVQSTREYQILKISVISGKT
STGYLSPGVSFDAIDMLGA
Download sequence
Identical sequences B2VYX8
PTRT_02618 XP_001932951.1.10593

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]