SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001952925.2.52611 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001952925.2.52611
Domain Number 1 Region: 662-721
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.02e-17
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 2 Region: 182-234
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000339
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Domain Number 3 Region: 385-437
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000821
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 4 Region: 715-772
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000252
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 5 Region: 579-629
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000011
Family Classic zinc finger, C2H2 0.027
Further Details:      
 
Domain Number 6 Region: 522-567
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000236
Family Classic zinc finger, C2H2 0.027
Further Details:      
 
Domain Number 7 Region: 633-687
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000006
Family Classic zinc finger, C2H2 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_001952925.2.52611
Sequence length 1320
Comment uncharacterized protein Dana_GF17472, isoform A [Drosophila ananassae]; AA=GCF_000005115.1; RF=representative genome; TAX=7217; STAX=7217; NAME=Drosophila ananassae; strain=TSC#14024-0371.13; AL=Scaffold; RT=Major
Sequence
MCDVISAGRYDVCRLSILQPNADIWGGSRVMNNQGYGGIQWIQHSTAPDVCEVEVLENGA
EMAVQEAAAAFVDDGGEEDAEEDLDHMAAENLIFMARDGQLSEIIAANEAGGAVLVTADG
TTVAYAGSFDDDAQVVTEEVITDDWVQHQGAERVEIAAEQIAGISSSQELLDMEQDEYTA
LRPYPCDFCSRRFRKKASLNNHMLAHQNDRPHLCKLCGARFTRRAELISHFKAHAEAQDA
ADAEAAAAAAAAAVSASSIKYEYQSQRQLDEHFYEQEWSLSHQDQGQVRHEQHNHSEQQL
ISNHDVADAYPALVAPPAAPARGRISRLKPKEESSQFIVMAERQSSPNLGSNCLSPTEQP
TVASAQSGTAEPPPQPNYPILDDKKPFVCQQCGLAFAREKALVSHTKNHRMDSPYECNQC
QEMFWDNSSLQEHLKTHQFEESNSEYDPASAEDSASESEPEEQLYGDFYCAECGISFHRQ
DLLRRHAKQHIKQPEAQAGERNSTVAAGGEVDAKESSGGGNSCHTCGKSFPTALEMLAHA
EIHSRFPPFKCVLCGISFYEEQAIKRHLHTRHPNELKANSCVLCGKECRDRKALIKHAWD
HSREKCHSCSKCGKNFHNKARLKRHMASHRDKSVVCEVCHEEFPDGRTLSNHRHSHSTTS
PGKLFPCHECGKTFGSRSSQQIHVRIHTGERPYGCRYCWKAFADGGTLRKHERIHTGEKP
YACSVCPRAFNQRVVLREHIRSHHSGLDVARNTYHCTVCSEDFPSSNDLIQHLIQHSDSN
TAKQRQPITGPRKYKRRRKLQPHEIVQMRAESKEANGEGEALGEADRDGEEDDYASDIDI
CDFDVDQVDDSLFDIAESPKKEKRKRTSARTVPKHNASNGGAGTTGGDGSGKPTQSKENT
KLRYDSTSSQQSDRIWEEKFLQDSQTPLFQIDSLVVVNDTPLPPASPSESAALPKTRAAA
KLLSKPAEASTSATVSSYSAASVSRGRKKPASKTAGKAPSAISSSSRPRMIHTERARVTK
PAVGTDSSSKKTRSKVYVTRTETTSKLGALDKSCIVDDYEIISPATQPPNQISSSPLHIK
QEQEHQQQRVQLMYDDNLLIDAALLREKTYEKFNPSIVNDLEEILRSPLKHDRSSRLRFT
SESSTTPQFLPEEEQHLIKIEPTSPDLREMVESQTRVTSSSSSSARTSRHLRQITANNGP
RAGSQRFAEKSSPGAGGAHKKATSSASTVSKVGSSSSYLGYGVEAYSVNQCVPASGSTAD
VGSGFFSISEVVSAADAADAAAKAAAAGKSERKTRFFECEMCTAIFYDRAQLLEHVHIHI
Download sequence
Identical sequences B3LVX5
XP_001952925.2.52611

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]