SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001958190.1.52611 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001958190.1.52611
Domain Number 1 Region: 8-126
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 2.8e-37
Family Ribosomal proteins L24p and L21e 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_001958190.1.52611
Sequence length 149
Comment uncharacterized protein Dana_GF23649 [Drosophila ananassae]; AA=GCF_000005115.1; RF=representative genome; TAX=7217; STAX=7217; NAME=Drosophila ananassae; strain=TSC#14024-0371.13; AL=Scaffold; RT=Major
Sequence
MKQNPFVSSSRRKNRKRHFQAPSHIRRRLMSAPLSKELRQKYNVRSMPIRRDDEVQVIRG
HFKGNQVGKVVQAYRKKFVVYVEKIQRENANGTNVYVGIHPSKVLIVKLKLDKDRKAILE
RRGKGRLAALGKDKGKYTEETAAQPMETA
Download sequence
Identical sequences A0A1W4UCJ3 B3M857 B4IFX1 B4PH23 B4QPX8 Q9VVU2
FBpp0213182 FBpp0074833 FBpp0305858 FBpp0126841 NP_001262025.1.81976 NP_001303372.1.81976 NP_649070.1.81976 XP_001958190.1.52611 XP_002042631.1.34323 XP_002095681.1.41174 XP_002095689.1.41174 XP_016032462.1.80810 XP_017041528.1.74164 XP_017107832.1.53830 FBpp0074833 7217.FBpp0126841 7227.FBpp0074833 7245.FBpp0264584 7245.FBpp0264588 FBpp0074833 4v6w_CY FBpp0196479 FBpp0264584 FBpp0264588

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]