SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001960588.1.52611 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001960588.1.52611
Domain Number 1 Region: 463-567
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 9.56e-31
Family Calponin-homology domain, CH-domain 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_001960588.1.52611
Sequence length 994
Comment uncharacterized protein Dana_GF13432, isoform A [Drosophila ananassae]; AA=GCF_000005115.1; RF=representative genome; TAX=7217; STAX=7217; NAME=Drosophila ananassae; strain=TSC#14024-0371.13; AL=Scaffold; RT=Major
Sequence
MASVWKRLQRNFKRAAKFQFTASYHDLHLETTAKWRPSNLSIVWTRRSRREASAPLPWEP
DMMNPLVGNISWPVPDNHTISVTLFKDPRTHELEDKDWTFVIEDITPMGKKRVLANASIN
MRKYASIESTQQSFTLALKPVSKKITAASLELTISCVFLREGKATDEDMQSVVSMMSVNN
NCDVAPLDDLEDIPDLENFSEITDNLYDFTQQLEQMTTSLNGCIDAATPLSVPSLSEDPT
PLAESFNQLHFELDADGDRDREATNKLDLPTAASGSSSGASGGAAGDESLKTPSGAQSLV
DKTPIKTPVEAKTQQPKTPAETLLPRSVEGFSKVVTSTPLEPKSNKDTVKPKIGKALNFD
EKEKVADISVESLKDDSTKSVANSSTIKETPKAEEKTNKDVSSSSKRSELQPLNLKKSYE
PSPIPGPAPVINESLGSQSGVGSGSASVNNSLKPVEKIVLKENTPGQDLLEWCKEVTKDY
PNVKVTNLTTSWRNGMAFCAIIHHFVPELIDMSKLSAHEVVGNCKIAFDAAESLGIPRVI
EPRDMNLLTVPDKLAVMTYLHQLRAHFTGKQLKIEQIGSTADESSYVIGNYKSDIMSQSR
LSISRMKIQQSTFDDDILTALNKSEPLSPTSKKDVKNLILNNSMNILGKVLSPTKDKNSI
NASQHGSCQTPPPQEDTQDEAPQVGGKENGSLTGLDSHTANRILTRHKAMSEKAKLMMEK
LKLSNGSDAIDEERQQRLREQARRLILETRVKSGGSIESPTSPTKPKRFNFERTISPIHN
GAEEFFGDHVKKSDEKEPVSPSHRLSDPRVKGSPLQSFNGLVERISPKHEKKGDKLSYIE
SELEALEREQEAIDQKASSLEAKLRAVMGGNPKTEETEEQLLSQWFTLVNKKNALLRRQM
QLNILEQEKDLERKFTMLNQELRAAQSVEDWRKTEVQREKERLLLEELVTIVDKRDQLVQ
HLHNQEQAIEDDHEIARELEQVDISGGKDKCVLQ
Download sequence
Identical sequences B3MD77
XP_001960588.1.52611 FBpp0116624 7217.FBpp0116624

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]