SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001964440.1.52611 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001964440.1.52611
Domain Number 1 Region: 624-747
Classification Level Classification E-value
Superfamily Bromodomain 1.44e-31
Family Bromodomain 0.0011
Further Details:      
 
Domain Number 2 Region: 503-616
Classification Level Classification E-value
Superfamily Bromodomain 6.67e-31
Family Bromodomain 0.00021
Further Details:      
 
Domain Number 3 Region: 193-294
Classification Level Classification E-value
Superfamily Bromodomain 4.19e-27
Family Bromodomain 0.0014
Further Details:      
 
Domain Number 4 Region: 29-155
Classification Level Classification E-value
Superfamily Bromodomain 3.14e-25
Family Bromodomain 0.0011
Further Details:      
 
Domain Number 5 Region: 365-443
Classification Level Classification E-value
Superfamily Bromodomain 2.49e-18
Family Bromodomain 0.0023
Further Details:      
 
Domain Number 6 Region: 1298-1370
Classification Level Classification E-value
Superfamily HMG-box 5.37e-16
Family HMG-box 0.0013
Further Details:      
 
Domain Number 7 Region: 757-862
Classification Level Classification E-value
Superfamily Bromodomain 0.0000000128
Family Bromodomain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_001964440.1.52611
Sequence length 1650
Comment uncharacterized protein Dana_GF23180 [Drosophila ananassae]; AA=GCF_000005115.1; RF=representative genome; TAX=7217; STAX=7217; NAME=Drosophila ananassae; strain=TSC#14024-0371.13; AL=Scaffold; RT=Major
Sequence
MLSRKRRASSISSRQDEDPLQLDDSTPEQSPVQQTTTQSARKKRRLDPAELCQQLYDSIR
NIKKEDGSMLCDTFIRAPKRRQEPSYYEVVENPIDLLKVQQKLKTDSYDDLDDLMADLGL
LIGNAKAFYKPDSMEYQDAVSLWQHIQSQRQRILEANGLAEEEPRSKRISRQVRRLTSSV
EPGGDGDDDYNQYEELFASVMTATDPVGDRSMHRMFQLLPSKKIYPDYYDVIEHPIDLRL
IATKIQMNAYSSLVEMERDLLQMTKNACLFNEPGSQIYKDAKALKRIFTQRRIELESGKG
KMSRRIKSLSSAAIAALKEEVDSSDDEETSKKGEGPMWALFDHLYNAPGTSEHPGVTGPP
LGNSLWKLPVRRFHPEYFELIKRPISMSQIHTKLKKGDYANISDLTADLYLMLDNAKKAF
PSTHRTHKDAIKMLKLMNAKLVEESLEETSDMDEDDVDEMEAEIFTAVQPEKRKPGRPRI
NSNSNSNASHTPNSNSPKSNRIAINAAIKKKILSIQKYLVDYSVGNRRPIEMFMEKPPRK
IYPDYYDIIQSPIDMNTIEHNIRTDRYATVEDVVSDYRLMFSNCRQYNEEGSNIYEDANT
LERALNDKLKEFPGLVEVKKPLQKYSKVGRKPKAALITDRLWQFYETVREYQEPKGKRQL
SLIFTKLPSKIEYPDYYDIIKDPIDMERIAQKLKQGAYESLDDLAADFLLMLENACKYNE
PDSQIYKDALVLQQLTLQLKQQLRTERDSLPDVPLAVQELFLTLFTTLYNHQDEEGRCYS
DSLAELPEYDEQGDVPKIRGISLDLVKRRLDKGAYKRLDIYQEDIFACLERARKLSRTDS
DIFQDSIELQTYFIRKRDELCKDTLSSPALSFSLERLLADVEVMRQQKAQQEEQDQEQDK
EKDEFNAAKGESMTINQQVFSPGDYVYVQMPEHKIPSIACIERLWTSPTNEKLMQGSIFV
RPHETYHVTTRKFLEKEVFKTSISQTISMDKVLGMCCVMHIKEYIKMRPDRLPEKDVFVC
ESRYNIQGRCFKKLKNWPPAREGSSVKFVPREQPLELKRVMSVFKERIEKHKGELEELKL
QETLVEKEKPNVSCDPPPNAEPNSTYYQQYNTVCSGAIKTGDFVYVATQTGKQSVAQVQQ
IWEQNGKSYFKGPWLLPPAEVNYGLAKQFFRQELLLGTVEEVSPVVGIVGRCAVLEYGDF
ITSRPTEIPESDVYICESVYDEVKKAIRKLVVGNMRKFQHSPAVTEDETFYFKTPIKPGK
DVKNEMNDLGMLEDSMDGDTPSLSSDIAAMSSPAPSVNSTPLTSKIKAAKAAKKCLTGYI
LYSSEVRKSICQSNPDASFGDISRMVGTEWKNLPSSVKQTWEDRASKQNEETAAMRREMD
GDIQNSASPSPQVSHDTVGHGLTFECQWDKCDFQFEEMSDCMEHCMSDTTGHIQRHPQAG
MDFEYVCLWRNCPRIKKSTQAFPNVLRLIKHVREVHLSKCGKTLGPGERSKNYIPRRQKH
GPLATAMPLPSSNSPRNLDAVHLQQQQHQHVIHQPLHQHQLQQQTLVLGPPPEPLFVTVP
PRTTRVIHSEAYIKYIESLQTGSHLNVATCNNNWRRALTHVTPAQVVAKNPLPEHWLGPN
LRDQGNVVQALCHLRNFMLDDVLQIRRSCS
Download sequence
Identical sequences B3MTV5
FBpp0126372 7217.FBpp0126372 XP_001964440.1.52611

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]