SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001967432.2.52611 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001967432.2.52611
Domain Number 1 Region: 62-512
Classification Level Classification E-value
Superfamily Sema domain 6.02e-131
Family Sema domain 0.000055
Further Details:      
 
Domain Number 2 Region: 1381-1510,1719-1880
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.35e-43
Family p120GAP domain-like 0.034
Further Details:      
 
Domain Number 3 Region: 874-970
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000293
Family Other IPT/TIG domains 0.0079
Further Details:      
 
Domain Number 4 Region: 967-1055
Classification Level Classification E-value
Superfamily E set domains 0.00000000000356
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.063
Further Details:      
 
Domain Number 5 Region: 515-566
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000994
Family Plexin repeat 0.0022
Further Details:      
 
Domain Number 6 Region: 1074-1156
Classification Level Classification E-value
Superfamily E set domains 0.00000382
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_001967432.2.52611
Sequence length 1937
Comment uncharacterized protein Dana_GF21874, isoform B [Drosophila ananassae]; AA=GCF_000005115.1; RF=representative genome; TAX=7217; STAX=7217; NAME=Drosophila ananassae; strain=TSC#14024-0371.13; AL=Scaffold; RT=Major
Sequence
MNFFLSVLLIATLEKKYDTQVLAANLWPDRSSVQNELVNLTDANETIKVGKNLSNTITNI
ARFDTKLNHLLVDTITGRVFIGGVNRLFQLSPDLELSETVKTGPQNDSVECSILDCPLNA
VRSPTDNHNKVLLIDRATSRLIACGSLFQGTCTVRNLQNVSIIEHEVPDAVVANDANSST
VAFIAPGPPQHPVTNVMYVGVTYTNNSPYRSEIPAVASRSLEKTKMFQIASSAVTTGTRT
FINSYARETYFVNYVYGFSSERFSYFLTTQLKHSHHSSPKEYITKLVRICQEDSNYYSYT
EIPVECISEAQGGTKFNLVQAGFLGKPSSDLAQSLGITIQDDVLFAVFSKGDANTPTNNS
GLCIYSLKSIRRKFMQNIKSCFNGNGMRGLDFISPSMPCVLTKLQTIGEDFCGLDVNSPL
GGETPITSVPVAMFKTRLTAVAATSTSGYTVVFVGTSDGYLKKIVIESSLIANEYASFSV
DLGSSINQDMQFDNQNLYIYVMSESKVSKVKVFDCTDYKTCGDCLGARDPYCGWCSLENK
CSPRSSCQDDANDPLYWVSYKTGKCTTITSVVPHQLQRTTARTLELIIDHLPQLKENLIC
AFTTEDKALFTNATKKRNGVNCTTPRTDMLPQIEQGKHHFTAKLSVRTRNGPDLVSTDFT
FFDCSTHSSCTRCVSSEFPCDWCVEAHRCTHDTAENCRNDILVTGVSRIGPSYRSGPGFC
PTINATGDGSEVLVAGGTSKSIKVKVHIIGQFIVQTRFVCQFNIEGRVTSLNAQLLGDTI
YCDNMEFQYTSRSPNLTATFAVIWGGSKPLDNPHNIHVVIYRCREMADSCGICLALPEKY
NCGWCSSTNSCEVEEQCNKNKEGKTDWLNRSEICPNPEIHSFEPKTGPWEGGTNITIRGI
NLGKNYNDIYSGVRIAGINCMPFPQYYIDTKQIVCTVDSPGEQIYRNGKIVVQIGDYRGE
SQEDYEFVDPKILDFNPKFGPTSGGTEIHITGKHLNAGSRIQASINDHLACKILSADSTQ
AICRTSPSPGIIEGRLKMSFDNGPREFNDYNFKYVLDPTVEFVSSGPSGQIKVPKGIPAG
GIRILVIGTQFTSIQSPNIYVVYNNEMYASPCRVQSDIEMECSSPVIDLDGKIIDAEKPI
LLEYGFLMDNVLRVQNLSKINNNNFELYPNPEYFAFEEKIKYFKSEYLTINGRNLDRACK
ETDVEVRIGNGFCNITSLSRQQLTCRPPPEATATNSMNGPEVVVRIGSALQFRIGILSYE
SSNIILDWGENVIFAVIATIVILLLIFVALLVAYKKKSSESNRVLRNMQEQMDILELRVA
AECKEAFAELQTEMTDLTGDLTSGGIPFLDYRSYAMKILFPNHEDHIVLQWERPELLRKE
KGLRIFGQLIMNKTFLLLFIRTLESNRYFSMRERVNVASLIMVTLQSKLEYCTDILKTLL
GDLIEKCIEGKSHPKLLLRRTESVAEKMLSAWFTFLLYKFLKECAGEPLYMLFRAVKGQV
DKGPVDACTHEARYSLSEEKLIRQSIDFRPMNVYASIIQQPIFCNNLDMLPSHTENVSVK
VLDCDTIGQVKEKCLETIYKNIPSSQRPRKDDLDLEWRTGATGRVILYDEDVTSKTESEW
KKLNTLQHYNVPDGAGLSLVPKQSSIYNFSILSDKNEKSHKYETLNISKYTSSSPTFSRA
GSPLNNDIHDNGVRYWHLVKHHDSDMQKEGERVNKLVSEIYLTRLLATKGTLQKFVDDLF
ETIFSTAHRGSALPLAIKYMFDFLDDQAQLHGITDPEVVHTWKSNSLPLRFWVNLIKNPN
FVFDIHKSNIVDSCLSVVAQTFMDSCSTSDHRLGKDSPSSKLLYAKDIPEYRKWVDRYYR
DIRDMSPISDQDMNAMLAEESRLHTTEFNTNCALHELYTYAVKYNEQLTVTLEEDEFSQK
QRLAFKLEQVHNIMSAE
Download sequence
Identical sequences B3N1J7
XP_001967432.2.52611 XP_014759164.1.52611

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]