SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001969274.2.56816 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001969274.2.56816
Domain Number 1 Region: 956-1100
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 6.28e-35
Family Toll/Interleukin receptor TIR domain 0.00047
Further Details:      
 
Domain Number 2 Region: 760-894
Classification Level Classification E-value
Superfamily L domain-like 5.21e-17
Family Ngr ectodomain-like 0.019
Further Details:      
 
Domain Number 3 Region: 271-362,422-503,628-720
Classification Level Classification E-value
Superfamily L domain-like 6.21e-16
Family Ngr ectodomain-like 0.098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_001969274.2.56816
Sequence length 1114
Comment LOW QUALITY PROTEIN: uncharacterized protein Dere_GG25330, partial [Drosophila erecta]; AA=GCF_000005135.1; RF=representative genome; TAX=7220; STAX=7220; NAME=Drosophila erecta; strain=TSC#14021-0224.01; AL=Scaffold; RT=Major
Sequence
MEHSRLWDLRSEVRERRFKWTSDGQRRQPQQQQQQQQQLGWCNNKDDPPNSHQKSKSNND
ARNLNSRIRVRDRVRVESGLPGEMRTGGVNCSTGLFYIREDYCEIYCGEFGENGTCSISN
NIVTTEDYQMKLVFLVLHIRWTDPVFHKWNIYKIGNETDYELIKISVQGIRSAVDKRIMP
GVHYLGLVGIREINGYDIYLSSMLITEADVHYINGPQVVTLKYLYDNPNNSMITNNYIRK
TMNSTKQIKIYNPNTYEKSTLTIEENVFHEKYNMSTLTFTGLILEGLTERTFENLTSLRY
LFFENVVLKDLSFLRSSTLQRSLRYCILNVENTVDLKSFEQFTNLEIIEVSRYKLFKNLT
ALICDPYTSHCLFTFGINKVACPSQCNCTYNREKFQLEIDCLLKNLTNIPSLPVPKKGDS
ALFFQYNLLAELPNNTLEGYKDLKSLDVSYNQLTSLSISQLPERLYHLDIRHNRITTLSP
QVVDYLFSVSTFNQFGNKWNIYCDDYHLQDFLWYRDRLLRIVPSKFEAIMEYMEVSSNAS
YLGNFFVEDKDKLYLEANEDAIIGALGTSNENSNSKLMETLNHVIWLFSGAYDEIILHHL
NASCPYRCLCCFERQTGEFLINCQNLTLDLYKITNPESLIVSGHASIQKLHMSQNLLREL
PLHLLPENITYLDVRNNFLKYLDDGVVAFLEHRENITKTELSGNPWECNCRAKAFLSFLR
RHEPLEYEIVLRRANITQDRCPVDCICCVDSSNSDALTLMIDCSGKKLREIPPLPTPAFG
QTTLIFERNNLEKWPSSLLPGLSSVTRFYLANNSLAHIEQLPGKLEHLDISNNNFSALDD
RVRVLLQERMSSSQMKLSLFGNPWTCTCEQKDFLQFVKEQAKNIANPSAIQCGDTGRSLL
EVEETDICPSVLIYYTSLAVSLLVIALSINVFICFRQPIMIWFYEHEICLSLAVRRELDE
DKKYDAFLSFTHKDEELIEEFVDRLENGRHKFRLCFYLRDWLVGESIPDCINQSVKGSRR
IIILMTKNFLKSTWGRLEFRLALHATSKDRCKRLIVVLYPDVENFDDLDSELRAYMVLNT
YLERNNPNFWNKLMYSMPHAMPLKRSRSDAETKV
Download sequence
Identical sequences B3N7X2
XP_001969274.2.56816

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]