SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001982697.1.56816 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001982697.1.56816
Domain Number 1 Region: 69-520
Classification Level Classification E-value
Superfamily Sema domain 6.8e-132
Family Sema domain 0.000043
Further Details:      
 
Domain Number 2 Region: 1389-1518,1727-1888
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.54e-43
Family p120GAP domain-like 0.034
Further Details:      
 
Domain Number 3 Region: 882-978
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000134
Family Other IPT/TIG domains 0.0076
Further Details:      
 
Domain Number 4 Region: 523-574
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000288
Family Plexin repeat 0.0022
Further Details:      
 
Domain Number 5 Region: 975-1063
Classification Level Classification E-value
Superfamily E set domains 0.0000000000045
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.076
Further Details:      
 
Domain Number 6 Region: 1082-1164
Classification Level Classification E-value
Superfamily E set domains 0.0000000513
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.068
Further Details:      
 
Weak hits

Sequence:  XP_001982697.1.56816
Domain Number - Region: 836-869
Classification Level Classification E-value
Superfamily Plexin repeat 0.000209
Family Plexin repeat 0.0043
Further Details:      
 
Domain Number - Region: 1194-1243
Classification Level Classification E-value
Superfamily E set domains 0.000342
Family E-set domains of sugar-utilizing enzymes 0.084
Further Details:      
 
Domain Number - Region: 670-706
Classification Level Classification E-value
Superfamily Plexin repeat 0.00903
Family Plexin repeat 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_001982697.1.56816
Sequence length 1945
Comment uncharacterized protein Dere_GG16425, isoform A [Drosophila erecta]; AA=GCF_000005135.1; RF=representative genome; TAX=7220; STAX=7220; NAME=Drosophila erecta; strain=TSC#14021-0224.01; AL=Scaffold; RT=Major
Sequence
MNFVLSVLLIAIFKDKYEHWLPSRAGGQTLAANIWSDKMTLQNEPINLTNANAPIKNAKS
LNSTITNVATFDTKLNHLLVDTITGRVFVGGVNRLYQLSPDLELSETVKTGPQNDSVECS
ILDCPSNTVRSPTDNYNKVLLIDRATSRLIACGSLFQGTCTVRNLQNVSIIEHEVPDAVV
ANDANSSTVAFIAPGPPQHPVTNVMYVGVTYTNNSPYRSEIPAVASRSLEKMKMFQIASS
AVTTGTRTFINSYARETYFVNYVYGFSSERFSYFLTTQLKHSHHSSPKEYITKLVRICQE
DSNYYSYTEIPVECISDVQGGTKFNLVQAGFLGKPSSDLAQSLGISIQDDVLFAVFSKGD
GNTPTNNSALCIYSLKSIRRKFMQNIKSCFNGNGMRGLDFISPSMPCVLTKLQTIGEDFC
GLDVNSPLGGETPITSVPVAMFNTKLTSVAATSTSGYTVVFAGTSDGFLKKVVIESSSVA
NEYASFAVDVGSEINRDMQFDNQNLYMYVMSQTKVSKVKVFDCSDYKTCGDCLGARDPYC
GWCSLENKCSPRSNCQDDANDPLYWVSYKTGKCTIITSVVPHQLQRTTARTLELIIDHLP
QLKENLICAFTTEDKALFTNATKKRNGVNCTTPRTDMLPQIEQGKHHFTAKLSVRTRNGP
DLVSTDFTFFDCSTHSSCTRCVSSEFPCDWCVEAHRCTHDTAENCRNDILVTGVSRIGPS
YRSGPGFCPTINATGDGSEVLVAGGTSKSIKVKVHIIGQFIVQTRFVCQFNIEGRVTSLN
AQLLGDTIYCDSMEFQYTSRSPNLTATFAVIWGGSKPLDNPHNIHVVIYRCREMADSCGI
CLALAEKYNCGWCSSTNTCEVEEQCNKNKEGKTDWLNRSEICPNPEIHTFEPKTGPWEGG
TNITIRGINLGKNYNDIYSGVRIAGINCMPFPQFYIDTKQIVCTVDSPGEQMYRNGKIVV
QIGDYRGESKEDYEFVDPKILDFNPKFGPTSGGTEIHITGKHLNAGSRIQASINDHLACK
ILSTDSSQAICRTSPSPGIIEGRLKMSFDNGPREFNDYNFKYVLDPTVEHVSSGPSGQLK
VPKGIPAGGIRISVTGTQFQSIQTPNIYVVYNGEIYVSPCQVQSDTEMECASPVVDVDSN
IIEAERPILLEYGFLMDNVLRVQNLSKIHNNHFELYPNPEYFIFEERVKYFKSEYLTING
RNLDRACKESDVEVKIGNGFCNITSLSRQQLTCRPPSEATATKSINGPEVIVRIGASLEY
RIGILSYESSNIILDWGENAIFAVIATIVILLLIFVALLVAYKKKSSESNRVLRNMQEQM
DILELRVAAECKEAFAELQTEMTDLTGDLTSGGIPFLDYRSYAMKILFPNHEDHIVLQWE
RPELLRKEKGLRIFGQLIMNKTFLLLFIRTLESNRYFSMRERVNVASLIMVTLQSKLEYC
TDILKTLLGDLIEKCIEGKSHPKLLLRRTESVAEKMLSAWFTFLLYKFLKECAGEPLYML
FRAVKGQVDKGPVDACTHEARYSLSEEKLIRQSIDFRPMNVYASIIQQPIFCNNLDMLPS
HTENVSVKVLDCDTIGQVKEKCLETIYRNIPSSQRPRKDDLDLEWRTGATGRVILYDEDV
TSKTESEWKKLNTLQHYNVPDGAGLSLVPKQSSIYNFSILSDKNEKSHKYETLNISKYTS
SSPTFSRAGSPLNNDMHENGLRYWHLVKHHDSDMQKEGERVNKLVSEIYLTRLLATKGTL
QKFVDDLFETIFSTAHRGSALPLAIKYMFDFLDDQAQLHGITDPEVVHTWKSNSLPLRFW
VNLIKNPNFVFDIHKSNIVDSCLSVVAQTFMDSCSTSDHRLGKDSPSSKLLYAKDIPEYR
KWVDRYYRDIRDMSPISDQDMNAMLAEESRLHTTEFNTNCALHELYTYAVKYNEQLTVTL
EEDEFSQKQRLAFKLEQVHNIMSAE
Download sequence
Identical sequences B3P9Q3
FBpp0134971 XP_001982697.1.56816

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]