SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001982757.2.56816 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001982757.2.56816
Domain Number 1 Region: 98-550
Classification Level Classification E-value
Superfamily Sema domain 1.83e-122
Family Sema domain 0.0000213
Further Details:      
 
Domain Number 2 Region: 1513-1638,1849-2034
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 8.11e-42
Family p120GAP domain-like 0.03
Further Details:      
 
Domain Number 3 Region: 902-991
Classification Level Classification E-value
Superfamily E set domains 0.000000000000434
Family Other IPT/TIG domains 0.027
Further Details:      
 
Domain Number 4 Region: 552-603
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000051
Family Plexin repeat 0.0025
Further Details:      
 
Domain Number 5 Region: 1110-1180
Classification Level Classification E-value
Superfamily E set domains 0.0000000000336
Family E-set domains of sugar-utilizing enzymes 0.075
Further Details:      
 
Domain Number 6 Region: 992-1070
Classification Level Classification E-value
Superfamily E set domains 0.000000098
Family Other IPT/TIG domains 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_001982757.2.56816
Sequence length 2069
Comment uncharacterized protein Dere_GG16467 [Drosophila erecta]; AA=GCF_000005135.1; RF=representative genome; TAX=7220; STAX=7220; NAME=Drosophila erecta; strain=TSC#14021-0224.01; AL=Scaffold; RT=Major
Sequence
MPKSNYKQLQFMKTKIIMLRKDFYCANFIHVLHGLCIITIFGSHNYSVSCIEELPPQLLS
PLNDIVAQFNLPSIPAQATVSTYGNRSIGNHIENVGDSQSKNYFTHLSFDFMHNVIFAGA
TNKILKLNENLRVLAEAVTGPIHDSPQCHAGGCPEDIETSLVNNFNKILVVSYAHDGILI
ACGSIRQGACEIYSLPRFPATPQFFAVPLAANDENASTYAFVGPARYAWNEEDILYVGTT
YTNVGDYRHDVPAISSRRLDNLNYAEFSIQQSIINIDVKYRDHFLVDYVYGFNSSEYAYF
IIVQKKSHLADEAGYVTRLARICITDRNYDSYTEITVQCTATENNVDYNILRDAKVTTAS
HKLAQKMGIKKDDHVLITVFSPSKEISNQPESKSAMCIYSIKDIEDMFIENIHLCFNGTI
KDRNLGYISGTINDGRCPIVGSLGNIYNFCSVGLKISGVSPITAHALFHFDNVSVTSVTA
TSTTDQQHSLAFLGTNMGVIKKVLLSGQSPGEYEEIVVDAGNPILPNTMMSPKKDFLYVL
SQRKITKLRIEHCSVYTNCSACLESRDPFCGWCSLEKRCTVRSTCQRDTSASRWLSLGSG
QQCIEFESIIPDKIPISELTHLHLIIRTLPEPFNAKYRCVFGNSTPIDAEILENGLGCAT
PPLDERPLIPTNTDHILVPLSVRSSETNKDFVSRYFAFFDCSHHGKCQECLQSSWGCNWC
IFDNKCVHKSLQCRNIENSVSTVGHCPHLKKNRPEILLPVRVPIEIRLEIENLPKPKSAH
AGFLCTIHIEAAQMLLPAHVESNKIVVCEKTPYFYETNTHEYQAKVVVTWNFQHYVDTAI
ITLYKCDVLGSHREHADCSLCVTRDPKYKCAWCSNSCVYNETCISDRISISSGFKASIEN
ECPLPRIDIIKPLSGPIEGGTLITIEGSNLGIREEDVRGKIFIGSVPCELENYEISVKIE
CRTGAALYEMSAPIKVANDAGYTESSVQFHFKNVMLTGLYPTIGPRSGGTQLSLIGKFLN
IGSTVRAFLDEYECHIDVTQASSSQVSCITSEATQPEPIRSLHLVIDGANRTLECQISAP
SITNTNPNRSNFGSYQLRTPPRQPCSIFNYTQDPRIMQIKPLRSFVSGGRVLTVHGIYLN
SIQKPELEVFYDNERINKTSCVVINSNQMECPSPPVNYKFETFKKTNKVLDTEMNLQNSS
LPTETRFKNEYYRKKRLADFGDNFRLYTTGGTAASYFVNNNMDVTTFVKVHETQLNLQLS
FVMDNVQLVRNLNKYFHDIRSIIVYLADPKYLPFPNDGIKLYKGDSLVIEGELLNLAADE
YDVNVTIGTSPCNITSLALTQLLCIPPEQQPLPTDENGVDQSTDLPLVVVKVGRNLRFVI
GYLKYDLNKPYVFSHALFVVILTVALLVIVFVIVLIIFRRKSTQAEREYKRIQIQMITLE
SNVRSECKQAFAELQTDMTDLTADLESTGIPTLDHVNYIMKVFFPGVSDHPILNSPKFRG
GSPQTNYDAAMIQFEQLIGNKYFLLMFIETLEAQRSSFSIRDRVNVASLLMVVLMNKMEY
ATEILKSLLLRLIDKSLASKHPQLMLRRTESVVEKMLTNYLAICMYDYLKEYAGSNLFLL
FKAIKHQIEKGLVDAITNDARYSLSEERLLHEQVTHSVVILHILQDDLDEKVQCRVNDWD
TISQVKLKILDAIFKNTPFSMRPSVHEVDLEWRHGRGGHLTLQDEDLTTKTVNGWKRLNT
LAHYGVKESAVMSLIARQNDNYHIPYSKNQNSAPYHNFYFINNSQSHIIINNDIESGLQQ
PRLYHLVKPNIPDHYMNIKNSVLSGGSPAFQSSHVVSNCIDRVNKTIPEVYLTRLLATKG
TIQKFVDDFFSIILTVNEELPPAVKWLFDLLDEAARRHDIADTDIVHAWKSNCLPLRFWV
NFIKNPDFIFDVNKTYTVDSCLSVIAQTFMDACSTSEHRLGKDSPSNKLLFAKDIPNYRI
MVKEFYRDVSRLPQISDQEMSTAMQQLSIRQSEEFDTISALKELYIYITKYKDQIMESLD
TDINCRKMHLSRKLGNVAATLDGDCTSNC
Download sequence
Identical sequences B3P9W3
XP_001982757.2.56816

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]