SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001984521.1.65300 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001984521.1.65300
Domain Number 1 Region: 868-1091
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.14e-53
Family DBL homology domain (DH-domain) 0.00018
Further Details:      
 
Domain Number 2 Region: 127-241
Classification Level Classification E-value
Superfamily BRCT domain 4.8e-19
Family DNA topoisomerase II binding protein 1, TopBP1 0.068
Further Details:      
 
Domain Number 3 Region: 259-307
Classification Level Classification E-value
Superfamily BRCT domain 0.0000000698
Family DNA-repair protein XRCC1 0.062
Further Details:      
 
Weak hits

Sequence:  XP_001984521.1.65300
Domain Number - Region: 1083-1200
Classification Level Classification E-value
Superfamily PH domain-like 0.00451
Family Pleckstrin-homology domain (PH domain) 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_001984521.1.65300
Sequence length 1351
Comment GH16512 [Drosophila grimshawi]; AA=GCF_000005155.2; RF=representative genome; TAX=7222; STAX=7222; NAME=Drosophila grimshawi; strain=TSC#15287-2541.00; AL=Scaffold; RT=Major
Sequence
METIEEQSKTVLSFGNGCNNSSKSNNLVTVCRRACSYFTYAAQEEVKQANLKQTAALYQV
YEDFTEMSIMSKMPTRICLVGEAGKDEGTLQAAESFGLPVIQSETGLDIINDMEWRTLYV
LTDFEDEIFDAIHKQKECILGPPALKYAAEMKQTLGQNTRPIYNYAMRGVVTCFTGIRKK
DELTRLVNLIHSMGGCIKKDLNTKTTHLICNHSGGEKYQYAKTFRLTVVRPAWVYAAWSA
RDSLEFEATQDSFTKAHRLKAFEGQKVCFFGFPAEEHQHMVDVLLENGGVCAELDDPECS
HVVMPNTGAVLTSTSNSTSTTSTDTNHSTNTKAQLSSNTPKSTPTKTASNSDAAADAALQ
QQQQQEQGQQQPASDKENQSDELDDLHFDPRLFVEAGDLQQPEELPLPDDLADEEDVQAS
TPKSSKQPSIIITAGTPTTSNGSPLSPCEFQSHTESLSPILKAPVKLLTIETINECDMET
DDLMETGIENDLKRKRDSFDSVSLMSVDSFALPASTKKPKLIRTGSITRTLKRSMSFVAD
RTPIIKTLRTRRSSIAVADTSTFLGSETIEADDSVCSLASINSTLNESIRKPVKALRNIC
DRITRSSSRRAERGEATPECGLLDSGFKTPKAPLQRFGAGSASATKKTAKRLFGPVASGL
SCSLTFSSNHASTSNANTQVNEATSTIACSVAATSMLPMQVTSSISTTTPSSSSTATSSS
TAVQIIDNAAPALRASTPPAADEPMQMVVDEHTTVSKPEPKNHNTHILKSDWFWYTIQNG
YANEMDYLFGDYLDSITNTPSTDRRDSLPITLNKRKRKRFSQRIQLEGTPLGSGKRRSSV
SDAGLLSVSNSFFDCTTSPDKLENDKLLHVEPEVTEATPTKKSMRYNHFMDFFTTESNYV
GIMDTILNLFKNKLEELAETNDPLLNKSEIKTIFGNFLPIHEVHQSMLEHLRKLHANWRE
DCLIGDIIIQHRDELIKAYPPYVNFYEQMKEQLLYCDREYPRFHAFLKINQTKPECGRQS
LQDLMIRPVQRLPSISLLLNDILKHTSNSNKDHARLEEALKAIKQVTLHINEDKRRTESR
MAIFDIFNDIDGCPAHLVSSNRSFISKCEVNELSDSLSGRGDSLLLYLFSDSIELCKRRS
RGFNTAKSPSTAKTHKHIKLISLNTIRFVIDITDSPRAFGLLQRGEKEKLYTFSIIDEET
DKLVYLKKLCMQITAHTCRTDPDKMLMSRTSLELEVDISDVNVSTLSKAFKLAAKTRLKV
GRAFSFNKTPNKLKRAVSTMMTSPFGSTNSLTPASQLAQMRLASCTNINEVADEECSSMR
SSSPSSQSEMLVVPPLSVQPTRKNKAVVGRI
Download sequence
Identical sequences B4J114
XP_001984521.1.65300 7222.FBpp0150418 FBpp0150418

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]