SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001986618.1.65300 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_001986618.1.65300
Domain Number - Region: 406-455
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0144
Family Pseudo ankyrin repeat 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_001986618.1.65300
Sequence length 1140
Comment GH21462 [Drosophila grimshawi]; AA=GCF_000005155.2; RF=representative genome; TAX=7222; STAX=7222; NAME=Drosophila grimshawi; strain=TSC#15287-2541.00; AL=Scaffold; RT=Major
Sequence
MYFETKWVFHQPRSWIETNFQKRECIKFIPCPKDDTKCCCGQAQITHQTIAGIESGSPGD
LWLPTKHTRPQPTDAYGTIEFQGGAHPTKAQYVRLSFDTRPELLVQLFTKEWNLELPKLL
ITVQGGKANFDLQAKLKKEIRKGLLKAAKTTGAWIFTGGTNTGVTKQVGDALLLEGQQRT
GRVVSIGIAPWGIVERNHELLGHNREVPCHSISSPRSKLAVLNNRHAYFLLVDNGTQAKY
GAELILRRKLEKFISNLKLHPFTHSSTPVVCLVIEGGTNTIRAVLEYVTDSPPVPVVVCD
GSGRAADLLAFVHKYASDGEEQPVLESMRDYLIGTIQKTFEVGLDSAEKLYQELLQCTRN
KNLITVFRIQEKPEGEAQELDQTILTALFKSQHLSPPEQLSLALTWNRVDIARSEIFVYG
QEWPIGALDEAMMQALEHDRIDFVKLLLENGVSMKKFLTIPRLEELYNTKHGPANTLGYI
LRDVRPHIPKGYIYTLHDIGLVINKLMGGAYRSYYTRRKFRPIYAKVMNSYANACRKSSS
YQYQRYAGANSLSLVTGLLPFTTEMALFEFPFNELLIWAVLTKRQQMALLMWTHGEEALA
KSLVACKLYKAMAHEAAEDDLDTEIYEELRSYAKEFESKGNKLLDFSYRQDAEKAQRLLT
CELHSWSNQSCLSLAVAANHRALLAHPCSQVILADLWMGGLRTRKNTNFKVILGLIMPFY
IRQLDFKSKEELQQMPQTEEEHLENQNLDNDDSDRSQPDAEALLADSYSVRDTKVHENGK
VSLTDSDPSQFREFFHLSEYTNEIKQHQPLRLKKKFHEFYTAPITKFWADSIAYMFFLIM
FSFTVLVRMKPMPRWQEWYSIAYITTLGFEKVREIISSEPVAITHKFSVWAWNMWNPCDG
AAIILFLIGLAFRFRPTTMDIGRVIYCVDSIYWYLRILNILGVNKYLGPLVTMMGKMVKN
MIYFVVLLAVVLMSFGVSRQAILYPNSEPTWRLIREVTYQPYFMLYGEVFADDIDPACGE
EPHMTPCVTGHWVTPITMSMYLLIANILLINLLIAVFNNIFNEVNSVSHQVWMFQRFTVV
MEYQQKPVLPPPFIAFCHFYSLLKYCVRKAKGEPGMRKFSFVPCESNNQSACSPSPIERE
Download sequence
Identical sequences B4J9S1
FBpp0155368 XP_001986618.1.65300 7222.FBpp0155368

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]