SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001987409.1.65300 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001987409.1.65300
Domain Number 1 Region: 200-305
Classification Level Classification E-value
Superfamily SH2 domain 2.83e-23
Family SH2 domain 0.001
Further Details:      
 
Domain Number 2 Region: 328-374
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000275
Family SOCS box-like 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_001987409.1.65300
Sequence length 383
Comment GH21907 [Drosophila grimshawi]; AA=GCF_000005155.2; RF=representative genome; TAX=7222; STAX=7222; NAME=Drosophila grimshawi; strain=TSC#15287-2541.00; AL=Scaffold; RT=Major
Sequence
MSNGENNTNSRTQNQGQGAVDANTSGSAAAGIANRARSQNPSSQGLLALGNMEQTAGAVA
TKAATKEKRSWFHSLTRRKKSDSASSSLTVAASSHAVQLHTNNNNEPMEASCSTAASVGN
NCSSSSNNSTIGGVMRKRKEKKNVFTRLGKKMGLGLSALRNWHSMGDDCDCDGGTTDAMY
EFLSPPIASEPTLPFTHDYMRFISKKWLERQESPNVVMYTTCSEMLNQVWYWGEISRRDS
QRQLSDKPTGSFLVRDSETSGSQFTLSFRIMNVTLHYRLEYRDQFWHFEELKYGSIVQMI
DDILHRCTNDNFVCFVKVPNEMQPPFPVILKYPLSRYLNMPKLQDLCRRVLQRQMPVAEL
AKLPVPAQMLEYLSVERELVFQS
Download sequence
Identical sequences B4J8B7
7222.FBpp0155813 FBpp0155813 XP_001987409.1.65300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]