SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001991836.1.65300 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001991836.1.65300
Domain Number 1 Region: 7-109
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.4e-32
Family Calponin-homology domain, CH-domain 0.000041
Further Details:      
 
Weak hits

Sequence:  XP_001991836.1.65300
Domain Number - Region: 155-184
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000114
Family LIM domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_001991836.1.65300
Sequence length 884
Comment GH11854 [Drosophila grimshawi]; AA=GCF_000005155.2; RF=representative genome; TAX=7222; STAX=7222; NAME=Drosophila grimshawi; strain=TSC#15287-2541.00; AL=Scaffold; RT=Major
Sequence
MSELRGTKALEFWCQRTTKGYNNVKIENMTTSWRDGLGFCALIHFYRPDLIDFDQLKKTD
IYYNNDLAFTTAAKYLGIPPLLDAEDMVANAVPDRLSVLTYLSQFYHVLTRKAAHGENSS
PLKYTRPKIEKVEESSIFVELSPQPQIGQKVAGVRRDSCQKCQFPVFLAERVFIEKHVYH
RTCLKCKQCSVQLSPNILFDDIQNMYCSDKCLNANNQHLNRTEHEHETISNDTDNLQELQ
RIEIVSKVRTQINEEDESSLEKERTNESSFIPHDIKLSSCDSIDNIDALSNKSTDSSIKE
GLETVPNPTTPSIEETNLQIPEEPTLEGEDKNNENNDKKKTESLDLEDTDVPSLQPEHSV
TTSKERLDCVEDKVEVKSVKESSGNNLNPFTDSDDDEHTSDDQQEISVETMQTHVKIKSK
SDISYNPFDSSDDEIELAKPLYQSHEEKLTLDRAPNPSTLQTLKAQFDEHNAEVKMSSPR
SNSPASNDSRNKSHKKHLKYNKRPAPAPPKPERLNASTSKTINEKDKALLIGQDSEQVPE
LRSSAKRRLIPLDQSLLAQDNLELNSHSEHQNQQSTYKDSDDYYRRMLMPPALDSPKFDL
DPIAHFAHTPEKLQNNAMDNHNDSIISGVDMNVSGQSYPDNKSSHGKWKHRKGPAPAIPI
TPRKALQMIPLQEIRHELEIIEVQQQGLEKQGVVLERMIRERCEGSGKDVQTTGDLSSTL
TAVTSEASTKNCKEVEDLILQLFELVNEKNELFRRQAELTHIRRQQRLEQEHADIESEIR
ILISQPERNKTDSDKLREETLIARLVEIVELRNKVIDCLEIDRLREAEEDLSIKQSLELY
NAGRDSSAPKASGEKASKKEKRGVKDVHKLIKYKSLLRRSGKSE
Download sequence
Identical sequences B4JLK8
XP_001991836.1.65300 FBpp0145760 7222.FBpp0145760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]