SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001995557.1.65300 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001995557.1.65300
Domain Number 1 Region: 33-209,255-365
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.09e-44
Family Calponin-homology domain, CH-domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_001995557.1.65300
Sequence length 367
Comment GH17695 [Drosophila grimshawi]; AA=GCF_000005155.2; RF=representative genome; TAX=7222; STAX=7222; NAME=Drosophila grimshawi; strain=TSC#15287-2541.00; AL=Scaffold; RT=Major
Sequence
MSTLNRPKSPHTPTTIKKGEKEDSFWDKFSTLGRKRGTREVKKVQEEGKYAIDSPGSPSQ
FDIPPEDYALREHEQRAVIDPQSSNDPEVLKLQQILIDWINDELAEQRIIVQKLDEDMYD
GQVLHKLWEKLTGKKLDVPEVTQSEQGQHEKLNIVLSAVNHTLGFHQKIPKWSVASVHSK
NIVAILHLLVALVRHFRAPVRLPENVFVTVVIAEMSAGFMNAQKYQEQITSEYDDLGMRC
EKDAFDTLIDCAPDKLAVVKKSLITFVNKHLAKLNFEINDLNTDFRDGVYLCLLMGLLGG
FFVPLHEFHLTPQDPDQMVNNVAFAFDLMQDVGLPKPKARPEDIVNMDLKSTLRVLYSLF
TMFRDYA
Download sequence
Identical sequences B4JWT3
XP_001995557.1.65300 7222.FBpp0151601 FBpp0151601

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]