SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001999627.1.58863 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001999627.1.58863
Domain Number 1 Region: 11-241
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.83e-65
Family BAR domain 0.000000782
Further Details:      
 
Domain Number 2 Region: 286-361
Classification Level Classification E-value
Superfamily SH3-domain 6.43e-23
Family SH3-domain 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_001999627.1.58863
Sequence length 367
Comment uncharacterized protein Dmoj_GI22969, isoform A [Drosophila mojavensis]; AA=GCF_000005175.2; RF=representative genome; TAX=7230; STAX=7230; NAME=Drosophila mojavensis; strain=TSC#15081-1352.22; AL=Scaffold; RT=Major
Sequence
MAFAGLKKQINKANQYMTEKMGGAEGTKLDMDFMDMERKTDVTVELVEELQLKTKEFLQP
NPTARAKMAAVKGISKLSGQAKSNTYPQPEGLLAECMLTYGKKLGEDNSVFAQALVEFGE
ALKQMADVKYSLDDNIKQNFLEPLHHMQTKDLKEVMHHRKKLQGRRLDFDCKRRRQAKDD
EIRGAEEKFAESLQLAQVSMFNLLENDTEHVSQLVTFAEALYDFHSQCADVLRGLQETLQ
EKRAEAESRPRNEFVPKTLLDLNLDGGGGGLIDDGTPSHISSSASPLPSPMRSPAKSMAA
TPHRQQQPCCQALYDFDPENPGELGFKENDIITLLNRVDDNWYEGAVNGRTGYFPQSYVQ
VQVPLPN
Download sequence
Identical sequences B4K588
XP_001999627.1.58863 XP_015022464.1.58863 XP_015022465.1.58863 XP_017873588.1.65068 XP_017873589.1.65068 XP_017873590.1.65068 FBpp0172186

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]