SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002000778.1.58863 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002000778.1.58863
Domain Number 1 Region: 31-148
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 5.1e-30
Family Insect pheromone/odorant-binding proteins 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_002000778.1.58863
Sequence length 154
Comment Odorant-binding protein 99b [Drosophila mojavensis]; AA=GCF_000005175.2; RF=representative genome; TAX=7230; STAX=7230; NAME=Drosophila mojavensis; strain=TSC#15081-1352.22; AL=Scaffold; RT=Major
Sequence
MKLFILLLSLTLAFADHHEGHSHDHDHGSGYVVKTHEDLVRFRNICAEQVHASAEDVAKY
VKWDFADEEKSRCYLKCIFEHFGLFDATHGFDVHKIHEQLAGGSHVDHADEVHQKIADCA
DNNAQGSDACTWAYRGGMCFMRSNLQLVQQSVKA
Download sequence
Identical sequences B4K602
FBpp0171552 XP_002000778.1.58863 XP_017866839.1.65068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]