SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002007374.1.58863 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002007374.1.58863
Domain Number 1 Region: 507-669
Classification Level Classification E-value
Superfamily A middle domain of Talin 1 9.42e-65
Family A middle domain of Talin 1 0.0000408
Further Details:      
 
Domain Number 2 Region: 2300-2492
Classification Level Classification E-value
Superfamily I/LWEQ domain 2.62e-51
Family I/LWEQ domain 0.00014
Further Details:      
 
Domain Number 3 Region: 678-800
Classification Level Classification E-value
Superfamily I/LWEQ domain 2.16e-49
Family I/LWEQ domain 0.0000843
Further Details:      
 
Domain Number 4 Region: 770-906
Classification Level Classification E-value
Superfamily I/LWEQ domain 1.16e-42
Family I/LWEQ domain 0.0002
Further Details:      
 
Domain Number 5 Region: 1852-1983
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 1.48e-32
Family VBS domain 0.00034
Further Details:      
 
Domain Number 6 Region: 1236-1372
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 2.67e-31
Family VBS domain 0.012
Further Details:      
 
Domain Number 7 Region: 203-317
Classification Level Classification E-value
Superfamily Second domain of FERM 1.44e-30
Family Second domain of FERM 0.00000936
Further Details:      
 
Domain Number 8 Region: 318-408
Classification Level Classification E-value
Superfamily PH domain-like 1.5e-25
Family Third domain of FERM 0.0000536
Further Details:      
 
Domain Number 9 Region: 1093-1218
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.000000000439
Family alpha-catenin/vinculin 0.026
Further Details:      
 
Domain Number 10 Region: 2018-2142
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.00000188
Family VBS domain 0.015
Further Details:      
 
Domain Number 11 Region: 962-1062
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.00000647
Family I/LWEQ domain 0.004
Further Details:      
 
Weak hits

Sequence:  XP_002007374.1.58863
Domain Number - Region: 1478-1561
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.00053
Family I/LWEQ domain 0.011
Further Details:      
 
Domain Number - Region: 1712-1813
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.000691
Family alpha-catenin/vinculin 0.03
Further Details:      
 
Domain Number - Region: 83-134
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00184
Family Ubiquitin-related 0.056
Further Details:      
 
Domain Number - Region: 1594-1666
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.00314
Family alpha-catenin/vinculin 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_002007374.1.58863
Sequence length 2856
Comment uncharacterized protein Dmoj_GI12908, isoform A [Drosophila mojavensis]; AA=GCF_000005175.2; RF=representative genome; TAX=7230; STAX=7230; NAME=Drosophila mojavensis; strain=TSC#15081-1352.22; AL=Scaffold; RT=Major
Sequence
MSTLSLRIQLEGGRVTKTIQFQPNTTVFDACKIIRDKFAEAVQGQPSEYGLFISDEQNQQ
GVWLEAGRTLGYYILHNQDTLEYRRKLRTLRVRMLDGAVKTILVDDSQPVSQLMVVICTK
IGITNHEEYGLVREDNEAQNENLPDNKFATLTLKRKFTEKDRDAKMESLRKKLKTDDEMN
WVDVGRTLREQGIDESETVLLRRRFFFSDQNIDSRDPVQLNLLYVQARDAILDGTHPVTQ
DKACEFAGIQVHIQFGPYNEAKHKPGFLDLKDFLPQSYVRVKNIEKKIFAEHKKHYELTE
IDAKVLYTKTARELPTYGVTFFLVKEKMNGKNKLVPRLLGVTKDSVLRLDERTKEILVSW
PLTTVRRWGASPNTFTLDFGDYANQYYSVQTTEAEQIVQLIAGYIDIILKKKQTKDHFGI
EGDEGSTMVEESVAPSKATFLQHETNRVEKLNLESLAHPGIMRPYDGERTFTQNEMQTVQ
YGAFVGQVNHAHQPPTTKEVRISSVNLTEPQRALIGYISAGQDVLIRADEELRTKAPIQE
LGSDLRSIEWRENTLDTSKQAVSSHVATMSAATAQIITASQPDEVDTEAISASVSQIAQT
IPEVTKEVRLIAALMENDTNGDQLLEAARNLCNAFSDLLKAAEPESKEPPQHLINAATRV
GEATTHVLSTIAEEEAPENRDLHDMLVDLGKAVANTTAALVLRAKNIAASCEDDQARNRV
IAAASQCALATSQLVACAKVVAPTLHNAACREQLEAAARNVARAVNSLCEVCNEASTDPK
LKADLMDAARDVSKSLLDMLEHVKLSTREHAHRTSQELSPVENVIIGTDVLVSTNDPQEM
VRHARTLGQTTAQLIQSIKGEADQQEDADMQRRLLSAAKQLADATAKLVEAARLCSSNPH
DSDNQNALRRAAEELREITTSTANTPAMKRGLIQRLEYHSKLAASAATQCISAAQNAVQH
SQDHQTKESLLQDCKRVADTIPRLVTSVKTTRAQPDDAHAQLNLIEAAEQFIEPALQVSK
SSRALRPTVTDIPSATQLSKSALHLGQAVSELHSVAQRARDACGGQELESALEAVRKLHH
VLDDTRQAALAGQLRPLPGETVENTADELRKSAKNVGIALSQLLSSVLQGQRQYAGAAGR
DTALALGEFTKSVHGVAATTQNPAIIDCADDVVTSSAQLIEQAQRTLKGVSDPQALTQAG
RDVTGALSRTVDCIPGQREVDAALRNVSDLSEILSVSEFPPSNRPYAELQSELKQVAEQL
STAGGQIVQSYASPALLADSSQQFAANYRDLLSVSMQMAGQAQTDEPVRSQMIDSLRNVS
TQSCSLLSTAKSIAADPGQPNAKNLLLAAARSVTESINQLVDASIQSAPGQKECDNAIRN
IDALRRMLDYPHEPINEMGYFDCVEQATAKSRNLGYAISEMINNAKQSQHVEFSQSVNNV
NESIQGLMESSSQAAYLIGVSHPSSVAGRPGIIDQAQLTWAYQGIRQHCDIVSSAQSGKP
QMISALTVIAKHTSYLCSICRQASMNTNNPVAKNEFIVLAKQVATATSDLVQDIKAIEDN
PTGGNRDRLVEPLLEAVKAVRQYASSPEFTSVPAKISAEGRKAQEPVIQAGRGVIDGVVE
MVKAAKSLALTPDNPPVWQQLSMHSTPVSESVKRLVDNIRDKAPGQAQCEQVLHTLGTCT
RELDSCALAANAQGLSRRRDNNLHGFSGQTMNAAAELLDKLEPIRVAGKNNAEQLGHAVG
EISRYVVPMVNGAIGACTHIVHSQQQMSLINQTKSVVESAITLVQSAKDSAGNPRATHAH
PRLDEAIDGTREAIQELQQAVEKINAETGIVTGLMEQVNRAITRLTDKRQSLLNASYSDS
FVDYQTRMVATAKEIARLGNEMNAKSSVEPAVLPQLAVEMTQHYQLLTQDSVGASTTTTS
PDVAMRIRSTVIDLGRSISSMIQSSAGGASPNDSSAQKEIARNAREVSEKVAQVLAALQA
GSRGTQACINAAHTVSGIIGDLDTTIMFATAGTLHSDGDGSFADHREHILQTAKALVEDT
KVLVTGAAGTQDQLANAAQNAVSTITQLAEAVKRGACSLGSSQPDSQVMVINAVKDVASA
LGDLINCTKLASGKPIHDPSMQGLKESARVMVLNVSSLLKTVKAVEDEHTRGTRAMEATV
EAISQEMRAMQTPPPVGSAQVGPEDLIRVTMNVTAATAKAVAAGTSNLQADIVAAANLGR
RAISDMLIVCRSVAWNCAETDELRVRTLEAGSSVAESYRELLNGILHNCSADDRMHLSRR
VAKCVTDLVAMARLLKGSDWIDPEDPTVIAENELLGAAASIDAAAKKLASLRPRRQADVK
IELDENMKFDEMILEAAKGIMGASAALVRAANAAQRELIDQGKVARRPLTSSDDGQWSEG
LISAARLVAAATHSLVEAAQNLVRGVGTEEMLISTAKQVAASTAQLLIACKVKSNPNSEA
GRRLQAAGNAVIKSTDNLVHAAQQGLEAEEEHSLKINTSMVDGMAQEINARSAVLRKEKE
LEEARQRLKHVRQAQRYAKNTQGFTTDESDTEYAYGTLNRSQNNTLGRGGGAYYGSQSGD
LPSSPSYYTGSGAGSQQKHHYNYASPQPQHFHHPGAVSPPPSNYAGMDDVNGDFPPPPPP
LSTTISNMQTATSTHSFRSNPKLTANAVPRPYPGSPVGGAGSNGFTTISASTPTNANNYQ
QSFESSSIKTQNSSTSGAPPTVPPPPPQKPTGNRNLEACVQDLHDKTFGQGGVVEITGGN
AYPGQNYEGYTSRYETRNFDKTANTSSNSESGLVKPLESSFSQMTLNTDGGKISIVDQGS
ERLTSMTQRVMERKSFTTTTESRSETKTEKHSFRLE
Download sequence
Identical sequences B4KZ53
FBpp0162125 XP_002007374.1.58863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]