SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002015247.1.64850 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002015247.1.64850
Domain Number 1 Region: 873-997
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.54e-28
Family Nuclear receptor ligand-binding domain 0.00000055
Further Details:      
 
Domain Number 2 Region: 772-851
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.45e-26
Family Nuclear receptor 0.0000191
Further Details:      
 
Weak hits

Sequence:  XP_002015247.1.64850
Domain Number - Region: 65-118
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.000732
Family beta-sandwich domain of Sec23/24 0.048
Further Details:      
 
Domain Number - Region: 293-354
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.00549
Family beta-sandwich domain of Sec23/24 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_002015247.1.64850
Sequence length 1004
Comment GL19597 [Drosophila persimilis]; AA=GCF_000005195.2; RF=representative genome; TAX=7234; STAX=7234; NAME=Drosophila persimilis; strain=MSH-3; AL=Scaffold; RT=Major
Sequence
MRDRLASLIVVKQEGGNNDTNNNNNNSHQDLPASMLLQPPIKCEASLYALSPYESSLYHE
INNNSCYRQNLNNQQPQQQQHHHHHQQHHSQAHQHQHQLLPPPLPPLIYPCRNLFPDGCD
ITHLACCSSSSTSTSTSTCTSVSSSSSSCSPTNNSNSSGSGTAAAAVTAGGATSAASQPR
KSKLLVERKVGKTDSNTDSATETTEAPATTATSATSTAGAATTTTATTTTTGGTTASATA
TTAAAIHTTKISQVRLNNPATTSMLLLQPNSSFSSLSPFDNFSSQSATTTTTSSVTAAAA
GHHHLQQQQQQQQHHHLQQQHLQHQQQQQQHHHQQILNSQQHLLKTESLLSHEEDQLISN
LNDVAGSHSELFSDLFFPSDSNNSLLSPTTSGYPDNPSGEDLTSSIENLTKLTCLRDKRL
SSIPEQQLSSEQEQQLCLLSLRSSSDPAIALHAQQQQQQQQPQQQQQQQEQQRQPGSGQI
QLISPIGGPLSCGSSLPSFQETYSLKYTSSSGSSPQQASSSSTAAATPTDQVLTLKMDED
CFPLTSAAEVMSGWNASPAPAPAQLQQLHTLQTQSQSQSQMSHSHPHPNSSSSGSNNNNN
GGSSGYNYHGHFNAVNASANLSPSSSASSLYEYNGVSASDNFYGQQQQHPKLLNYNSHNG
ERYSLPTFPTISELAAATAAVEAAAAASISASVGPTPVRRSSLPVQRTVSPAGTSAQSPK
LAKITLGQRHHAHAHAHAHPLQLSSAPNSSASSPASAAGADLQAGRLLQAASQLCAVCGD
TAACQHYGVRTCEGCKGFFKRTVQKGSKYVCLADKMCPVDKRRRNRCQFCRFQKCLVVGM
VKEVVRTDSLKGRRGRLPSKPKSPQESPPSPPISLITALVRSHVDTTPDPSCLDYTHYEE
PSMSEADKVQQFYHLLTSSVDVIKQFAEKIPGYLDLTPEDQELLFQSASLELFVLRLSYR
ARSDDTKMIFCNGTVLHRSQCQRSFGEWLNDIMDFSWESSQPGD
Download sequence
Identical sequences B4G744
FBpp0183704 XP_002015247.1.64850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]