SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002015416.1.64850 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002015416.1.64850
Domain Number 1 Region: 194-427
Classification Level Classification E-value
Superfamily PH domain-like 6.88e-82
Family SSRP1-like 0.00000486
Further Details:      
 
Domain Number 2 Region: 548-624
Classification Level Classification E-value
Superfamily HMG-box 1.57e-23
Family HMG-box 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_002015416.1.64850
Sequence length 727
Comment GL11071 [Drosophila persimilis]; AA=GCF_000005195.2; RF=representative genome; TAX=7234; STAX=7234; NAME=Drosophila persimilis; strain=MSH-3; AL=Scaffold; RT=Major
Sequence
MTDSLEYNDINAEVRGVLSSGRLKLTDQNIIFKNNKTGKVEQISVDDIDLINSQKFVGTW
GLRVFTKSGALHRFTGFRDSEHEKLGKFIKDAYSQEMVEKEMCVKGWNWGTARFMGSVLS
FDKDSKTIFEVPLSHVSQCVTGKNEVTLEYHQNDDAPVGLLEMRFHIPAVESADDDPVEK
FHQNVMSKASVISASGESIAIFREIQILTPRGRYDIKIFSTFFQLHGKTFDYKIPMDSVL
RLFMLPHKDSRQMFFVLSLDPPIKQGQTRYHYLVLLFAPDEETTIELPFSEAELRDKYEG
KLEKELSGPVYEVMGKVMKVLIGRKITGPGNFIGHSGTAAVGCSFKAAAGYLYPLERGFI
YIHKPPLHIRFEEISSVNFARSGGSTRSFDFEVTLKNGTVHIFSSIEKEEYAKLFDFITQ
KKLHVSNMGKDKSGYKDVDFGDSDNENEPDAYLARLKAEAREKEEEDDDGDDSDEESTDE
DFKPNENESDVAEEYDSNVEDDSDDDSDASGGGGDGGTDGSTKKKHKEKKNEKKEKTHKE
KEKIKKPTKKKDTGKPKRGTSAFMLWLNDTRESIKRENPGIKVTEIAKKGGEMWKELKDK
SKWEEAANKDKIRYQEEMRNYKSGAGGGSEDEKGGTSKATKKRKSEPSPSKKANTSGSGF
KSKEYISDDESTSDDQEKVKEIPKKKNKSTAEDKDKNSKKSESEGGDSDDASNASEDDDE
EEDEGSD
Download sequence
Identical sequences B4GBL1 Q293F6
FBpp0277246 7237.FBpp0277246 FBpp0175178 XP_001357531.2.19638 XP_002015416.1.64850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]