SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002017548.1.64850 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002017548.1.64850
Domain Number 1 Region: 12-157
Classification Level Classification E-value
Superfamily DEATH domain 2.98e-58
Family DEATH domain, DD 0.00000103
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_002017548.1.64850
Sequence length 449
Comment GL21462 [Drosophila persimilis]; AA=GCF_000005195.2; RF=representative genome; TAX=7234; STAX=7234; NAME=Drosophila persimilis; strain=MSH-3; AL=Scaffold; RT=Major
Sequence
MAKANGWCGSSSKYTRTTELRRVEDNDIYKLATILDVNACWRKLMSIIPKGLDVQACSAA
GAVKITANGGPKYTAQDISLIDGVAERLPPDQSISQVMIDEWKTSGKLNERPTVGVLLQL
LVEAELFSAADFVALNFLNEPKPERPADGPAAHFSLELGDDMDVDTEATDASYLPNTAAL
NAAAQGSLGFNLDYFDKHMVRRDKSVPQPSASVPPTAPPRSSRHQKNTASPSASTGSTSA
TATTPNIPNLTILNPSEQLQEPAQVEQPPPQNIPNLSILINSSAASMTTASTALENTSNG
SSSTDPPNIPIITLLIDNPAEISGPVAADAVSANSTTTPTAASLNNLPMISALNLNAENG
EAFHQDSGSTSSLSNDEDDDDDIDEEGDYADASLPNLSNSEQHNSNNDSSLTTVTGTSGD
NSFELTNDSSSASNDDYASNIPNLSELQQ
Download sequence
Identical sequences B4GDY7
FBpp0185569 XP_002017548.1.64850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]