SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002030196.1.34323 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002030196.1.34323
Domain Number 1 Region: 430-563
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000461
Family Ran-binding domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_002030196.1.34323
Sequence length 576
Comment GM25305 [Drosophila sechellia]; AA=GCF_000005215.3; RF=representative genome; TAX=7238; STAX=7238; NAME=Drosophila sechellia; strain=Rob3c; AL=Scaffold; RT=Major
Sequence
MLHCQVEGAKAEQCECPVMHSENSAETFSSVEPQASDCIQPLEVQSAKRTTNIEESFKVD
CKLSLNTLLSPINIIDPLRKQIDFQCNLGDLSFFGPVMCSISELNKEEQTLEPYFIPELY
MACAGKEVEQVAEETVIETGPQLKLPKNQPINDSITTETNETKLPPMEPLNVSRLAEFSE
PVMGKSNISIEEVNLKGAVGIIEPISDEPNIQPVESAEKLYPKSLAIQIPPLKIEDLISP
LIEKPRIATKLGLISFLTGNKLALTPSVRLSFGDRVTTRRNTKSKEIIQQQASKSLKALI
SVLTMQRRLAASQHDNSNNSRTKRFEQLKSSLSFSRVFRQNIFQSTSVIENRQLNTDGNS
LESGEPNFNSPSEHKEPLPIPYRLDAGEGLTCNGLNVSKDSVFSEVSESDVSETQNKLFA
MKKPQAGLKSIAKLSDILNNGRVLFSQPVRLFCFNKLKEWKRQGKVPRSHESPYRSPSFS
GEGQIEVIEHDGSYYIVLHDKVSGELIIHMRVDERWRIDYMTKSSYSCRWTNINYANCRD
GILERIACSFREPSHAAEFVARVRNSALQSRLECSS
Download sequence
Identical sequences B4HF13
XP_002030196.1.34323 FBpp0206782

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]