SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_002031185.1.34323 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002031185.1.34323
Domain Number 1 Region: 615-674
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.69e-16
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 2 Region: 138-190
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000044
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Domain Number 3 Region: 339-391
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000551
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 4 Region: 668-725
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000398
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 5 Region: 473-520
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000123
Family Classic zinc finger, C2H2 0.029
Further Details:      
 
Domain Number 6 Region: 533-582
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000236
Family Classic zinc finger, C2H2 0.027
Further Details:      
 
Domain Number 7 Region: 586-640
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000446
Family Classic zinc finger, C2H2 0.028
Further Details:      
 
Weak hits

Sequence:  XP_002031185.1.34323
Domain Number - Region: 422-445
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00029
Family Classic zinc finger, C2H2 0.044
Further Details:      
 
Domain Number - Region: 1255-1281
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00567
Family Classic zinc finger, C2H2 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_002031185.1.34323
Sequence length 1282
Comment GM25840 [Drosophila sechellia]; AA=GCF_000005215.3; RF=representative genome; TAX=7238; STAX=7238; NAME=Drosophila sechellia; strain=Rob3c; AL=Scaffold; RT=Major
Sequence
MNNQRYGGIQWIQHHVTAGDSSEVDIVESDEGAGASGEDLDHVAAENLIFMAREGQLSEI
MAANEAGRTVLVTADGTTVAYAESFDDDAQVVTEEVITDDWVQHQGAERVEIAAEQIAGI
SSSQEFLDMEQDEYTALRPYPCDFCSRRFRKKATLNNHMLAHQNDRPHLCKLCGARFSRR
AELISHFKAHAEAQDAADAEAAAAAADSSSAIKFEHQTQRQLDDHYYEHDWPLFQQQPEQ
EHAQPNIHQQHQIVEEGGIQLVASYPDTVAPPAAPSRGRISRLKPKEESRQFIVISDKSA
EDSRPYMEPEPAQPVVTTSQLIAVEPPPQPNFPVLDHSKPFVCQQCGLAFAREKALVSHT
KNHRVDSPFECNQCQEMFWDNSSLQEHQKTHQFEESNSEYDPASAEESGSESEADEQLYG
EFYCNECGISFHRQDLLRRHAKLHCKPSDQAAVGSNSDVTAGGDLELAKDSSGHCCNTCG
KSFPSALEMLAHAEIHARFPPFKCVLCGISFYEEQAIKRHLHTRHPSELNANSCVLCGKE
CRDRKALIKHAWDHSREKCHSCSKCGKNFHNKARLKRHMASHRDKSVVCEVCQEEFPDGR
TLSNHRHSHSTTTPGKLFPCIECGKTFGSRSSQQIHVRIHTGERPYGCRFCWKAFADGGT
LRKHERIHTGEKPYACSVCPRAFNQRVVLREHIRSHHSGLDVSRNTYHCTVCSEDLASSN
DLIQHLIQHSDSNTAKQRQPVTGPRKYKRRRKLQPHEIAHMRAANKNGNGEEKEAIGEGD
GEECASDIDFCDFDVENVDDIFDMAESPKKEKRKRGSAATKADAKPVTNGKAVKPAQDKG
KAKPRYDSTSSQQSDRLWEEKFLQDSQVALFQIDSLVVVNDTHLQPASSAVPANIPNTRG
GSKQQGKVQAKSVEGAENFNSSATTSDTTFSASTSTASSRSRKRAATTKTASKASPASNS
RPRMIHTEKAKVTRGVGGDSSSSSTKKTRSKTYISRTESHNLSLDKSRSSASNMVDDYEI
ISPATHPPNQISSSPLHIKQEQEQQQRVQLMYDDNLLIDAALLREKTYEKFNPSIVNDLE
EILRSPLKHERNSRLRFTSESSTTPQYLHEEEQNLIKIEPTSPDLREMLEGQQRVIAHSG
STPSSSSSARTSRHLRQITANGARAGSKRSTGGVASKTSAIPGVVAKKSNTATKVSSSSS
SYLSYGVDSYNVNVPASANNGDVGGGFFSISEVVSAADAADAAAKAAAAGKSERKTRSFE
CEMCSAIFYDRAQLLEHVHIHI
Download sequence
Identical sequences B4HEL4
FBpp0207317 XP_002031185.1.34323

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]