SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002032402.1.34323 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_002032402.1.34323
Domain Number - Region: 368-408
Classification Level Classification E-value
Superfamily RING/U-box 0.0574
Family RING finger domain, C3HC4 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_002032402.1.34323
Sequence length 424
Comment GM23534 [Drosophila sechellia]; AA=GCF_000005215.3; RF=representative genome; TAX=7238; STAX=7238; NAME=Drosophila sechellia; strain=Rob3c; AL=Scaffold; RT=Major
Sequence
MVKRTDGTESPILAEDGGDGHDKPRLRYGELVILGYNGYLPQGDRGRRRSKFVLHKRTEA
SGVKRSKHYIVQSPQTSKAILDANQHSISYTLSRNQAVIVEYKEDTETDMFQVGRSSESP
IDFVVMDTLPGDKKDAKVMQSTISRFACRILVNRCEPAKARIFAAGFDSSRNIFLGEKAT
KWQDNVEIDGLTTNGVLIMHPKGSFCGGNAKCGLWRECSVGGDVFSLRESRSAQQKGQPI
YDECNILQDGTLIDLCGATLLWRSAEGLQHSPTKHDLEKLIDAINAGRPQCPVGLNTLVI
PRKVNIGDQVNQPYVYLNCGHVQGHHDWGQDENTGARRCPMCLELGPVVTLCMGLEPAFY
VDVGAPTYAFNPCGHMATEKTVKYWANVEIPHGTNGFQAVCPFCATPLDGATGYIKLIFQ
DNLD
Download sequence
Identical sequences A8JR89 B3P8D2 B4HFZ5 B4PNY8 B4R260 O77237
FBpp0268926 FBpp0083913 FBpp0111820 FBpp0111821 NP_001097890.1.81976 NP_524466.1.81976 XP_001982086.1.56816 XP_002032402.1.34323 XP_002098486.1.41174 XP_016035937.1.80810 FBpp0216748 7227.FBpp0083913 7245.FBpp0268926 FBpp0130944 FBpp0083913 FBpp0083913 FBpp0111820 FBpp0111821 FBpp0205011

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]