SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002033081.1.34323 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002033081.1.34323
Domain Number 1 Region: 33-181
Classification Level Classification E-value
Superfamily L domain-like 2.52e-33
Family Internalin LRR domain 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_002033081.1.34323
Sequence length 188
Comment GM20606 [Drosophila sechellia]; AA=GCF_000005215.3; RF=representative genome; TAX=7238; STAX=7238; NAME=Drosophila sechellia; strain=Rob3c; AL=Scaffold; RT=Major
Sequence
MSKATTIKEALKRWEEREQQNSLTAKVIDLQFQWPPIEKMDSTLGTLVQCERISMSTNMI
EKIFGLSGMKCLKVLSLSRNYIKQISGLEAVAETLEELWLSYNLIEKIKGLTGLKCLKVL
YISNNLIKDWSEFNRLAEIESLEDLVVVGNPLSEGLDEPTWRAECIKRLPTIRKLDGEPV
VLNEEPQL
Download sequence
Identical sequences A1Z7U2 B3N7H4 B4HSR7 B4P414 B4QH84
NP_610483.1.81976 XP_001970320.1.56816 XP_002033081.1.34323 XP_002089785.1.41174 XP_016026674.1.80810 FBpp0208481 FBpp0267345 FBpp0087638 FBpp0087638 FBpp0087638 FBpp0202083 7227.FBpp0087638 7245.FBpp0267345 FBpp0129106

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]