SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002033174.1.34323 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002033174.1.34323
Domain Number 1 Region: 106-225
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.57e-33
Family cAMP-binding domain 0.000019
Further Details:      
 
Domain Number 2 Region: 235-365
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 6.28e-30
Family cAMP-binding domain 0.0000941
Further Details:      
 
Domain Number 3 Region: 7-49
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000000000235
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_002033174.1.34323
Sequence length 411
Comment GM20562 [Drosophila sechellia]; AA=GCF_000005215.3; RF=representative genome; TAX=7238; STAX=7238; NAME=Drosophila sechellia; strain=Rob3c; AL=Scaffold; RT=Major
Sequence
MSSDSSRRIQVPEELKEVLLQFSISFLVEQPPDVIDYAVEYFTKLQSERPSVSHTDQSTD
DQLSVNSQDADAEPPVMASSRRKSVFAEAYDPEADDDDDGATAVFPKTDEQRARLVESVK
NVLLFRSLEKEQMNQVLDAMFERKVQPGDFIIRQGDDGDNFYVIESGVYKVYINDKHINT
YNHTGLFGELALLYNMPRAATVQAETSGLLWAMDRQTFRRILLKSAFRKRKMYEELLNSV
PMLKALQNYERMNLADALVSKSYDNGERIIKQGDAADGMYFIEEGTVSVRMDQDDAEVEI
SQLGKGQYFGELALVTHRPRAASVYATGGVVKLAFLDTEAFERIMGFLTDVLKRNIVIYE
QMFTDMARLLDVKAFERLLGPCMDIMKRNIDDYESQLVKIFGSKNNITDTR
Download sequence
Identical sequences B4HMB0 B4QHU9
XP_002033174.1.34323 FBpp0208435 FBpp0202039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]