SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002043830.1.34323 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002043830.1.34323
Domain Number 1 Region: 152-320
Classification Level Classification E-value
Superfamily PH domain-like 2.46e-37
Family Phosphotyrosine-binding domain (PTB) 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_002043830.1.34323
Sequence length 328
Comment GM17773 [Drosophila sechellia]; AA=GCF_000005215.3; RF=representative genome; TAX=7238; STAX=7238; NAME=Drosophila sechellia; strain=Rob3c; AL=Scaffold; RT=Major
Sequence
MKTKKFIDYFCIFYLLSNNLEEYVADIPFAGLFKGSTLNLSSDVVDGIGAVPGDREFLQS
PSMVRSAHVQNHRRSLSKQRYSALGEDFSASRVWAEIDTIFENIGNEVSTVEQEVEELVE
DPASLSLADSRQSLHIRDPAELLLGRKPSAASSNWCHSPYTLIYGEIRYSLFYLGSTVIR
KLQGTLSTRKSIQKLKIDENLKSAASVSDFSLLENCTTSTKYLKAANHQTRLNVDIAVSC
VGVKFIDHEKKTAICCHDIENINCVSQDSEDLRYFAYITKEQDLHYCHVFMVDSLELAKE
IIMTLGQAFEVAYQLALSRQGTSLNEEC
Download sequence
Identical sequences B4IJC0
FBpp0199250 XP_002043830.1.34323

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]