SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002046606.1.90633 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002046606.1.90633
Domain Number 1 Region: 36-164
Classification Level Classification E-value
Superfamily N-terminal domain of cbl (N-cbl) 2.75e-58
Family N-terminal domain of cbl (N-cbl) 0.00000264
Further Details:      
 
Domain Number 2 Region: 251-337
Classification Level Classification E-value
Superfamily SH2 domain 2.75e-46
Family SH2 domain 0.00000752
Further Details:      
 
Domain Number 3 Region: 345-422
Classification Level Classification E-value
Superfamily RING/U-box 7.46e-39
Family RING finger domain, C3HC4 0.0000253
Further Details:      
 
Domain Number 4 Region: 166-250
Classification Level Classification E-value
Superfamily EF-hand 3.94e-36
Family EF-hand modules in multidomain proteins 0.0000195
Further Details:      
 
Domain Number 5 Region: 847-886
Classification Level Classification E-value
Superfamily UBA-like 0.0000144
Family UBA domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_002046606.1.90633
Sequence length 893
Comment uncharacterized protein Dvir_GJ12975 [Drosophila virilis]; AA=GCF_000005245.1; RF=representative genome; TAX=7244; STAX=7244; NAME=Drosophila virilis; strain=TSC#15010-1051.87; AL=Scaffold; RT=Major
Sequence
MATSRTSRIQSQPKIFPSIFSKLHGAISEACVSQRLSTDKKTLEKTWKLMDKVVKLCQQP
KMNLKNSPPFILDILPDTYQRLRLIYSKNEDQMHLLHANEHFNVFINNLMRKCKQAIKLF
KEGKEKMFDENSHYRRNLTKLSLVFSHMLSELKAIFPNGVFAGDQFRITKADAADFWKSN
FGNSTLVPWKIFRQELNKVHPISSGLEAMALKTTIDLTCNDYISNFEFDVFTRLFQPWVT
LLRNWQILAVTHPGYVAFLTYDEVKARLQRYIHKAGSYVFRLSCTRLGQWAIGYVTADGE
ILQTIPQNKSLCQALLDGHREGFYLYPDGQAYNPDLSSAVQSPTEDHITVTQEQYELYCE
MGSTFQLCKICAENDKDIRIEPCGHLLCTPCLTAWQVDSEGQGCPFCRAEIKGTEQIVVD
AFDPRKQHNRNATNGRQLQQDDDDTEDMGDFNIATSSLHALSTSAASQSSMEKHSPHTSP
RLGRRSTTPSLMAVQNDLYAGGTPALSLPSGSSSCSSSISGGSSSTTNCNQQQPQPSAPP
AATVISNGSGSSNNTSSSSSNSSSTQKTTNRMSAPLIGSSVINSTYGQKLPSKTDNGSAG
DTASISSYAILQNLQDGASSSATAAAAAAAAGGGGGGGAAAVAPPLPPRKSPGMETPVKP
NSATPSSSKSIDNIQCSLDNVPPQTTAPPIPPHVSSSVDTLAEDLMRQQRIASSTTSPVL
SLLDEMMVEVGPAETISGVIDTRPLEARGTLPANNSSSSNNNNNNNNSGSSTSSSSGCSG
VQDAASSHYTQLCTTTTSAAALAAAAALANGKKMTLKQPTPAGQQPLLYANVTINQKDCA
GTVPYENINLEYIARLMNAGYSKENAITALGISRNNIEMAGDILREFVSKNSA
Download sequence
Identical sequences B4LDS5
XP_002046606.1.90633 7244.FBpp0227392 FBpp0227392

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]