SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002047721.1.90633 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002047721.1.90633
Domain Number 1 Region: 123-178
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000000759
Family Tachycitin 0.044
Further Details:      
 
Domain Number 2 Region: 25-87
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000000034
Family Tachycitin 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_002047721.1.90633
Sequence length 180
Comment uncharacterized protein Dvir_GJ13591 [Drosophila virilis]; AA=GCF_000005245.1; RF=representative genome; TAX=7244; STAX=7244; NAME=Drosophila virilis; strain=TSC#15010-1051.87; AL=Scaffold; RT=Major
Sequence
MCQLKELIKPICLVLLAVGLPSSQADVFPQCANVDVDTFVMAIDDCASYIYCNGENSFRD
SCPNQTYFDAKAQECAFDDAGVCLEASGTTTAAALPSENNDELQAASTAPAAPEDTPAPA
GSRPHCDASGDGYHPHPERCEYYYSCIGGYLTIVRCPYTYGWDYAQQQCKPLSEAQCFSL
Download sequence
Identical sequences B4LE20
XP_002047721.1.90633 7244.FBpp0228008 FBpp0228008

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]