SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002047911.1.90633 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002047911.1.90633
Domain Number 1 Region: 61-117
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000000759
Family Antifungal peptide scarabaecin 0.081
Further Details:      
 
Domain Number 2 Region: 3-60
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000034
Family Tachycitin 0.036
Further Details:      
 
Domain Number 3 Region: 122-180
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000392
Family Tachycitin 0.073
Further Details:      
 
Domain Number 4 Region: 209-265
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000706
Family Tachycitin 0.021
Further Details:      
 
Weak hits

Sequence:  XP_002047911.1.90633
Domain Number - Region: 264-313
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00288
Family Tachycitin 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_002047911.1.90633
Sequence length 325
Comment uncharacterized protein Dvir_GJ11664 [Drosophila virilis]; AA=GCF_000005245.1; RF=representative genome; TAX=7244; STAX=7244; NAME=Drosophila virilis; strain=TSC#15010-1051.87; AL=Scaffold; RT=Major
Sequence
MNQICSYWPGSGYIGDPSDCHSWGYCKNNKLSARGECPNGLFYDAQSGTCQQAHLVRCAP
QYWELCAQRRRGEYVSDPLDCSKYKRCDDEGGKIEENYCAGGYVFSNRLQKCVLSANGCA
EETLSICGYMQNGTTLGDPLNCGLYLECQSGTGIRRACTAARYYNYNSGRCQTTRPKHCP
SNENSYKPANYPPPAMDVSVCTDFYQDDYSGIQLITDAQTCHGYYTCGSKYVLGIWHSCP
HGTHFQWWSQKCVTPESYSCPYDRCGNLNSSLVASINSGCSEYIYCQDQTSQQMGKCPED
LPYFDEKRGACIREFPNYTVCFMDG
Download sequence
Identical sequences B4LF65
7244.FBpp0226081 FBpp0226081 XP_002047911.1.90633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]