SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002049415.1.90633 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002049415.1.90633
Domain Number 1 Region: 661-934
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.18e-73
Family Protein kinases, catalytic subunit 0.00000198
Further Details:      
 
Domain Number 2 Region: 117-278
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.27e-33
Family Ankyrin repeat 0.00045
Further Details:      
 
Domain Number 3 Region: 9-109
Classification Level Classification E-value
Superfamily SH2 domain 2.56e-26
Family SH2 domain 0.00052
Further Details:      
 
Domain Number 4 Region: 270-409
Classification Level Classification E-value
Superfamily SH2 domain 4.31e-20
Family SH2 domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_002049415.1.90633
Sequence length 947
Comment uncharacterized protein Dvir_GJ21569 [Drosophila virilis]; AA=GCF_000005245.1; RF=representative genome; TAX=7244; STAX=7244; NAME=Drosophila virilis; strain=TSC#15010-1051.87; AL=Scaffold; RT=Major
Sequence
MAAYPRDDQMKWYHGRLTREAADDLLKQGYEDGTFLVRESSTAAGDFVLSLFHQGEVCHY
QIRRHGEDAFFSIDDKGQTKILHGLETLVKYYQQEPNGLVTKLSSPLPGDPPPHNTRSQG
VTNLLHRATSKNESKVVFELLKCGNRNFDAKNKDGQTALHLAALNCNEDILKLLLDARVQ
VNSSDSFGYQPLHYACRQKPASFIRTLIAAQANVQGRNIENGHVPLHEAAKHGNLEAVQE
LLAAQAPLLPRTSSGEFPFDLAKEAGQTAVEQFLLDYKLPPASTSREHWYHGTLKRDEAV
AILQQFAHQLQRKQQATGQPVDTSGCFLVRYSESPAAAGYVLTLLSGQVAKNFLISQADL
YQNGNKLPSSGSKFLYIDDGPYWPSLEHLVAHFMRFSYGLPVSLKYPVPPLPKPELPSFA
TIPRATQKQRDNHSAPGTPLSPHPSGSAYQAHVPALTITKKKQKENSSSMFNTLRIVSPK
KSLFDMNSLRKSKSKSKRSDSESSVSIMAAARANEELQAAAPIMKNLSFSTDFSNFNVDT
GEVYNVPRNNTPIEMPPIANKTEDEVEYFTKSDVAIERERAAALTANGYLPTMDVHMLLD
QPLQQLDGSGKQMSRLDSVISTGSTESEMAGYLQRKCSGGVGGGGANELNSAELEAAKQR
FLIHHEHLELDSEIGAGEFGSVYRGWLRMPGVQPVQRLEVAIKTLRDEKQQTLNKQEFLR
EASVMMRLEHKCIVRLIGISKGDMLMMVQELAPLGSMLQYILDHSDEMKVNYELKLWASQ
IACGMHYLETQHFVHRDLAARNILLTSRQQAKISDFGMSRSLSAGSDEYHFTQGGRWPIR
WYAPESFNNGIFSHASDVWSFGVTLWEMFALGAPPYGDISNVDAIKLVDSGQRLPQPNMC
PAYIYAVMQSCWNYHPRERPTFAYLMEFFSRDPEYQNLPELVQSVHI
Download sequence
Identical sequences B4LK19
FBpp0235986 7244.FBpp0235986 XP_002049415.1.90633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]