SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002049768.1.90633 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002049768.1.90633
Domain Number 1 Region: 194-427
Classification Level Classification E-value
Superfamily PH domain-like 4.06e-82
Family SSRP1-like 0.00000472
Further Details:      
 
Domain Number 2 Region: 550-627
Classification Level Classification E-value
Superfamily HMG-box 1.7e-23
Family HMG-box 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_002049768.1.90633
Sequence length 729
Comment uncharacterized protein Dvir_GJ21774 [Drosophila virilis]; AA=GCF_000005245.1; RF=representative genome; TAX=7244; STAX=7244; NAME=Drosophila virilis; strain=TSC#15010-1051.87; AL=Scaffold; RT=Major
Sequence
MVDALEYNDINAEVRGVLSSGRLKLTEQNIIFKNNKTGKVEQIAAEDIDLINSQKFVGTW
GLRIFTKSGALHRFSGFRDSEHEKLGKYIKEAYSQEMVEKEMCVKGWNWGTARFMGSVLS
FDKDTKTIFEVPLSHVSQCVTGKNEVTLEFHQNDDAPVGLLEMRFHIPAVESADEDPVEK
FHQNVMNKASVISASGESIAIFREIHILTPRGRYDIKIFSTFFQLHGKTFDYKIPMDSVL
RLFMLPHKDSRQMFFVLSLDPPIKQGQTRYHYLVLLFAPDEETTIELPFSEAELRDKYEG
KLEKELSGPVYEVMGKVMKVLIGRKITGPGNFIGHSGTAAVGCSFKAAAGYLYPLERGFI
YIHKPPLHIRFEEISSVNFARSGGSTRSFDFEVTLKNGTVHIFSSIEKEEYAKLFDFITQ
KKLHVSNMGKDKTGYKDVDFGDSDNENEPDAYLARLKAEAREKEEDDDDGDDSDEESTDE
DFKPNENESDVAEEYDSNVQSDSDEDSDASGGGGEGDSDAASKKKHKEKKREKKEKKEKK
HKEKERTKKTTKKKDSNKPKRATTAFMLWLNDTREQIKRDNPGIKVTEIAKKGGEMWKEL
KDKSKWEEIAAKDRQRYQDEMRNYKPGAGAGSDDEDSPSSKPVKKRTSEPSPAKKANTSG
SGFKSKEYISEDDSTSSEEAKKTNSEPAKKKSKTVEPTSNKTAKQSESEAEATEEETNES
NDDEDDASD
Download sequence
Identical sequences B4LM83
XP_002049768.1.90633 7244.FBpp0236191 FBpp0236191

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]