SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002052214.1.90633 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002052214.1.90633
Domain Number 1 Region: 819-877
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000017
Family Tachycitin 0.026
Further Details:      
 
Domain Number 2 Region: 29-80
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000497
Family Tachycitin 0.042
Further Details:      
 
Domain Number 3 Region: 978-1028
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000497
Family Tachycitin 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_002052214.1.90633
Sequence length 1033
Comment uncharacterized protein Dvir_GJ17435 [Drosophila virilis]; AA=GCF_000005245.1; RF=representative genome; TAX=7244; STAX=7244; NAME=Drosophila virilis; strain=TSC#15010-1051.87; AL=Scaffold; RT=Major
Sequence
MHGSLIYVCLLISLFYFSEGKPCPEKSRRHKTRCDAYYKCRDLPSNSHVWIPTKCNEGLV
YEHNVGSCVLPGEDWECITPGELESTSNSLPGKDADIIIVNTEDESGLLLKESSHLQDDD
KSVDIVLDATISSEESEDKKSPALPAQQASEYESSSSSQFDSSGDGELVDLDGQLQAATR
EGEVKIGHNSSQSAPMAMFMEPSSTNSGEHMTFNSQSGSPIDPNLTAHLQRLSQLIDGLQ
QKYQKTDKPQLEMRPDQLNAFLAHFDLKNHFDMINPLGSHMETTAPTTTTKPALASANAE
QPVPLPRPTVNKTLLQEHLTKHRMQPETKLILSSAQPFSSHGQGYANSQIVVNRPEGSVT
FTLPQYGHGSEQAQQNSLAQSHEYNDHEPKVSEETLKTVLELSKQMIAAQNLPKVLPNTA
YNGAFYAPPILQPVILTPHGNPFQQYYPMQNYESQPPPPPPRNHYVHHKKASGYNKKQPS
TTIIHNNVIPVHVSSTSSGEKEVLDTYGNSLGVYPSLNNNHKNNQMDDSNSSNNYYNKFM
TTMTTARPSSGMSVTTMSSQYSGQYAAPYASEFAQTTPRPFEEQPSAATVASYYTPSPHL
DENNAHRVFHAESYPTSMDIGMNMPRPMDGHSPYPMHIDPDRVKIRPNSHKIESMEVEAD
DAINANYVNSNANNNQKNNNRHVLTYSSAGSTDTGMLGMSHQLAPGSYVEQNYAMPQNVA
NAQQQQHDYQAPYMAGMSNSVYSDAVGSNMYSTGGGVGMGAGNSIQMMPGKTKYPSGLGQ
LVNFNGNFISLDVFQKSILPLITQSPSALTELGKVEVITCQAGVRQPNQTDCTRYFVCSK
KDGKVLTYSCPPYTGFNKQTRICDAATYAQCGNMPIFNGYSIEENRRQQMEALKMLAEAK
RRQEATLKSQSIANILKQYGSMQEPAAPAISSGIDQSLLDSYMVSLPEPSSTPRPTPAIA
TLPPISNSSGSVKKRKYYCREGDKIPDQTSISSYFVCYKTAQGQMKGHKMTCSKGLLFCP
RTLMCTLASKCSG
Download sequence
Identical sequences B4LVA9
7244.FBpp0231852 XP_002052214.1.90633 FBpp0231852

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]