SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002053416.1.90633 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_002053416.1.90633
Domain Number - Region: 34-60
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000141
Family Tachycitin 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_002053416.1.90633
Sequence length 61
Comment uncharacterized protein Dvir_GJ23348 [Drosophila virilis]; AA=GCF_000005245.1; RF=representative genome; TAX=7244; STAX=7244; NAME=Drosophila virilis; strain=TSC#15010-1051.87; AL=Scaffold; RT=Major
Sequence
MNCSCAWLVMLLLALLGTAWGSSCPTGFSSETNLCVKERPVHGTCPPGSTYQLNINKCVH
A
Download sequence
Identical sequences B4LYE0
FBpp0237765 XP_002053416.1.90633 7244.FBpp0237765

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]