SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_002054043.2.90633 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002054043.2.90633
Domain Number 1 Region: 633-692
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.02e-17
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 2 Region: 148-200
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000372
Family Classic zinc finger, C2H2 0.021
Further Details:      
 
Domain Number 3 Region: 353-405
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000125
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 4 Region: 681-715
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000454
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 5 Region: 548-600
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000327
Family Classic zinc finger, C2H2 0.027
Further Details:      
 
Domain Number 6 Region: 490-538
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000676
Family Classic zinc finger, C2H2 0.032
Further Details:      
 
Domain Number 7 Region: 604-658
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000562
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_002054043.2.90633
Sequence length 1297
Comment uncharacterized protein Dvir_GJ23014 [Drosophila virilis]; AA=GCF_000005245.1; RF=representative genome; TAX=7244; STAX=7244; NAME=Drosophila virilis; strain=TSC#15010-1051.87; AL=Scaffold; RT=Major
Sequence
MNNQDYGGIQWIQQHASAVDSETDMLENGAADSEVTAAYLVNGNATDEDLDHMAAENLIF
MARDGQLSEIIAANEAGGGTVLITDSGTVAYAESFDDDAQVVTEEIITDDWVQHQGAERV
EIAAEQIAGNNSSQELLDMEQDEYTALRPYPCDFCSRRFRKKGSLNTHMLAHQNDRPHLC
KLCGARFSRRAELISHFKAHAEAQVAADEAAAIKFEPQQQQRQADDQYYEQDWPLYQEQE
EEQVQDQMQQMEQEQLVEPQASYPAVSAVSAPTATRGRISRLKPKEESTQYIVIAEKQAT
DDLRQYMDCEELPLQPQLTGSTSIDASHSTECPDETAADAAQTLRFPVLDESKPFVCQQC
GLAFAREKALVSHIKNHRVNSPFECNQCQEMFWDNYSLQEHQKTHQFEESNSEYDPASAG
DDSASESEPDQLYGDFYCSECGISFHRQDLLRRHAKQQHKLTPDTDGGDGAGEGDGGGGG
DADAENAKDAAHCCHTCGKSFPSALELLAHAEVHARFPPFKCVLCGVSFYEEQAIKRHLH
TRHPHELKPNSCVLCGKECRDRKALIKHAWDHSREKCHSCSKCGKNFHNKARLKRHMASH
RDKSVVCEVCHEEFPDGRTLSNHRHSHSTTSPGKLFPCHECGKTFGSRSSQQIHVRIHTG
ERPYGCRYCWKAFADGGTLRKHERIHTGEKPYACSVCPRAFNQRVVLREHIRSHHSGLDA
VRGTYHCTVCSADLSSSNELIQHLIQHSDTNTAKQRQPITGPRKYKRRRKLQPHEIAHMR
AGNKDGEEYASDMELCDFDVENVDDLLDRTEPLPTTKKEKRKRAATNQAKAVTNGAAHNS
SSSAKSANSSSERLWDEKFLPANSNGNVGNADDAYKSFFQIDSLVVVNDTTLPPVSSSSS
TPSASKSRRGGKQPPTQTQAESSDKSGGGAGATASATMATTTAAAAATVEDSRKKSSKAA
KNTGTAAATSSSSRPRMIHTEKARVPPENASKKSRGRSYITRTSTSESSQLGLVKSSGVA
SSRIVDDYEIISPATQPPNQISSSPLHIKQEQEQQQQRVQLMYDDTHLLIHTAMLRDKPY
DKFNPSIVNDLEEILRSPLKHDRNARLRFTSESSTTPQFLPEEEQNLIKIEPTSPDLREM
VESQQRVTATGHTATPTSSSSSSSAARTSRHLRQITANSATRSAAKRHMDKSSSAFSAKK
STTSSPVAVSKPAGNSYLSYGVDSYNVNVVASANSSDVSSGFFSISEVVSAAHAADAAAK
AAAASKTERRTRCFECEMCSSIFPDRAQLLEHMHIHI
Download sequence
Identical sequences B4LVV8
XP_002054043.2.90633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]