SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002054128.1.90633 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002054128.1.90633
Domain Number 1 Region: 43-94
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000314
Family Tachycitin 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_002054128.1.90633
Sequence length 103
Comment uncharacterized protein Dvir_GJ24262 [Drosophila virilis]; AA=GCF_000005245.1; RF=representative genome; TAX=7244; STAX=7244; NAME=Drosophila virilis; strain=TSC#15010-1051.87; AL=Scaffold; RT=Major
Sequence
MRFAALLLVLAVCLCLASNALGQCIDTYKPGCKLPVEVGRPQRNCIDPTKYWMCSALNGE
AELFKCQPNTGFSQDRNACISWIDWVWKPCIEPPSRPTGWQSC
Download sequence
Identical sequences B4LWB4
XP_002054128.1.90633 FBpp0238679 7244.FBpp0238679

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]