SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002055433.1.90633 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002055433.1.90633
Domain Number 1 Region: 317-478,914-1088
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 4.29e-120
Family Mammalian PLC 0.00000987
Further Details:      
 
Domain Number 2 Region: 690-785,848-874
Classification Level Classification E-value
Superfamily SH2 domain 4.57e-28
Family SH2 domain 0.0001
Further Details:      
 
Domain Number 3 Region: 1105-1225
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.27e-26
Family PLC-like (P variant) 0.002
Further Details:      
 
Domain Number 4 Region: 575-687
Classification Level Classification E-value
Superfamily SH2 domain 1.62e-23
Family SH2 domain 0.00078
Further Details:      
 
Domain Number 5 Region: 15-135
Classification Level Classification E-value
Superfamily PH domain-like 1.43e-17
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 
Domain Number 6 Region: 175-318
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000392
Family Calmodulin-like 0.076
Further Details:      
 
Domain Number 7 Region: 816-860
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000333
Family SH3-domain 0.0013
Further Details:      
 
Domain Number 8 Region: 499-568,918-951
Classification Level Classification E-value
Superfamily PH domain-like 0.000000849
Family Pleckstrin-homology domain (PH domain) 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_002055433.1.90633
Sequence length 1231
Comment small-wing, isoform A [Drosophila virilis]; AA=GCF_000005245.1; RF=representative genome; TAX=7244; STAX=7244; NAME=Drosophila virilis; strain=TSC#15010-1051.87; AL=Scaffold; RT=Major
Sequence
MSCFSAMNTPLLGEMEQTICMLERGTIVTKLYGKQRRPDRRHLMLIRETRQLLWSTVAAQ
TRTEYEGTIQLREIREIRVGKNSKEFRLHADDCQRFESSKCFVIMYGNSFKLKSFSVVAL
SEIEADNWVRGLRYMVKDTIHSPYPLQIDRWLRREYYSFENVNSHLTKSDQSSQVTIKDF
KTFLSNVSCKMSTSKFMECFTDDIKRKHDLKFDDFSRLYQKLLLPVNFISVLGSAEFAYS
EDKKIVRPIEFKRFLETEQHDLNALDLNSISSFMRDFVQDVERDVQEPYLTISEFVDYLF
SKQNDLWDTRFDAVFMDMNQPLSSYWIASSHNTYLTGDQFSSESSCEAYARALRMGCRCI
ELDCWNGPDNLPYIFHGHTMTSKIKFMDVIKTIKDHAFTTSEYPVILSIEQNCSLEQQRN
MAHALIEVFGDMLLTQPCDRNELHLPSPNQLRRKIILKHKKLPQFDENVSAINLPAVGVN
NGTIASFSHRSSLGGATDDNENLQKILKKGLLYFKDPVDKSWNLYQFVLTQQELIYTSEI
SECRNGNSEDDDFGLSSCTLNSNMQQKQKDTSANDELHFGENWFHGKLEGGRQEADQLLE
TYKHLGDGTFLVRESATFVGDYSLSFWRRNRPNHCRIKLKHENGSIKYYLVENFVFDSLY
SLIVYYRKNMLRSSEFSIILKEPVPQPKKHESQDWFHPNTTKEQAEQGLLKLDIGSFLVR
PSVQSVNAFVISFTINRKIKHCRIMQEGRLYAIDTMQFESLVSLIHYYMRNPLYRNVKLV
HPVSQELLRQSLIENAQLHGEHSNNDSSGASNYMGSNLEEYVTCKALYSYKADKPDELSF
PKHAIITNVQRNNSMWWKGDYGGMIQQHLPANYVKVIDSATEDYNSVTEEGNDGRTDSIE
IYGAVASLFESNEPGIIIKLQIQTPTMQNPFIIGFDNQETAYEWIKSIQDAALIASQLAT
ERRKKERTARVAKEMSDLIIYFRSVPFRDHSWIFQEMSSFPETKAEKQFIQQNMPLFLSY
HRNQISRVYPKGQRLDSSNFNPVPFWNIGSQMIALNYQTGDKAMQLNQAKFRNNGQCGYI
LKPAFMMSENFNPNNPLSDGLIETKVSVRIIAARHLFRGGKSNNPQIVVEIVGASFDSGI
KYRSKVNENGFNPIWNESFEFTVHNPQFALLRFEVQDEDMFAETHFIAQACYPLTCVRQG
YRSVILRNKFSEELELSSLLVNIEISNREST
Download sequence
Identical sequences Q86RA6
7244.FBpp0233208 FBpp0233208 XP_002055433.1.90633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]