SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002056404.1.90633 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002056404.1.90633
Domain Number 1 Region: 185-241
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000000392
Family Tachycitin 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_002056404.1.90633
Sequence length 405
Comment uncharacterized protein Dvir_GJ10929 [Drosophila virilis]; AA=GCF_000005245.1; RF=representative genome; TAX=7244; STAX=7244; NAME=Drosophila virilis; strain=TSC#15010-1051.87; AL=Scaffold; RT=Major
Sequence
MLLQRYAALLAVFLLLWCGSGAQLQVQAQSGYNYVRPELPTTAGGGAIATRLQPGAYPTG
TALPLTPAPATAYGAGLFPSPAVSYTPSGQATTAFGAPATAPVGSVPNLPRRPTGSGLQS
ASSAARGGPYGPQPQYSNTAGASSGARVPLADDYNDGADGDYSAIPGEPGVDYPVYAQVP
RTNFDCSQQPLPGYYADIEAQCQVFHICALNRTYSFLCPNGTVFSQETLVCVWWNQYDCV
SAPSLYANNAYIYDYSGTSSSSSSSNLNLNANVYRGGSQPVNTAYGAVAPSTPAGGALRA
TGAPQIAGYNAQRGAYASPSPTPTQAQSLYGAGAIIRPAGVSGTVSAPGANRLAPATAAA
GLAATAAGLLPDNAVGSFAQPVVAVGNREYLPPATVSQRQQRTQA
Download sequence
Identical sequences B4M4F5
7244.FBpp0225346 FBpp0225346 XP_002056404.1.90633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]