SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002057935.1.90633 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002057935.1.90633
Domain Number 1 Region: 22-82
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000000000418
Family Tachycitin 0.021
Further Details:      
 
Domain Number 2 Region: 86-149
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000000000706
Family Tachycitin 0.0059
Further Details:      
 
Domain Number 3 Region: 179-228
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000000497
Family Tachycitin 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_002057935.1.90633
Sequence length 237
Comment uncharacterized protein Dvir_GJ15813, isoform A [Drosophila virilis]; AA=GCF_000005245.1; RF=representative genome; TAX=7244; STAX=7244; NAME=Drosophila virilis; strain=TSC#15010-1051.87; AL=Scaffold; RT=Major
Sequence
MKLFLCAIAVTLCVAATTGAAEFECPKPNGQFADEVQCDKYYVCDEGVPKAKLCPDGLVF
DPLNRKINKCDQPFNVDCEDRTELQEPKSTKYCPRKNGFFAHPEASVCNIFYNCIEGDAL
EMKCTVGLHFDEYSGTCVWPDTAKREGCGDPEKKSESGFACPKDQPKTDARGQVVTHPKY
PHPTDCQKFYVCLNGEDPRDLGCQLGEVYNDLTEMCDAPENVPGCEDWYKDTDDKKD
Download sequence
Identical sequences B4M9Y4
7244.FBpp0230230 XP_002057935.1.90633 FBpp0230230

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]